PDB entry 2k1b

View 2k1b on RCSB PDB site
Description: Solution NMR structure of the chromo domain of the chromobox protein homolog 7
Class: transcription regulator
Keywords: alpha/beta protein, Chromatin regulator, Nucleus, Repressor, Transcription, Transcription regulation, Structural Genomics Consortium, SGC, TRANSCRIPTION REGULATOR
Deposited on 2008-02-25, released 2008-03-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Chromobox protein homolog 7
  Species: Homo sapiens [TaxId:9606]
  Gene: CBX7
  Database cross-references and differences (RAF-indexed):
  • Uniprot O95931 (Start-72)
  Domains in SCOPe 2.08: d2k1ba_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2k1bA (A:)
  mhhhhhhssgrenlyfqgeqvfavesirkkrvrkgkveylvkwkgwppkystwepeehil
  dprlvmayeekee
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2k1bA (A:)
  eqvfavesirkkrvrkgkveylvkwkgwppkystwepeehildprlvmayeekee