PDB entry 2k0r

View 2k0r on RCSB PDB site
Description: Solution structure of the C103S mutant of the N-terminal Domain of DsbD from Neisseria meningitidis
Class: oxidoreductase
Keywords: immunoglobulin, mutant, N-terminal domain, Disulfide bond reductase, Cytochrome c-type biogenesis, Electron transport, Inner membrane, Membrane, NAD, Oxidoreductase, Redox-active center, Transmembrane, Transport
Deposited on 2008-02-13, released 2008-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-03-31, with a file datestamp of 2009-03-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiol:disulfide interchange protein dsbD
    Species: Neisseria meningitidis serogroup B [TaxId:491]
    Gene: dsbD, NMB1519
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JYM0 (1-127)
      • expression tag (0)
      • engineered (47)
      • engineered (101)
    Domains in SCOPe 2.07: d2k0ra1, d2k0ra2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2k0rA (A:)
    maldandllppekafvpelavaddgvnvrfriadgyymyqakivgktnpadllgqpsfsk
    geekedeffgrqtvyhheaqvafpyakavgepyklvltyqgsaeagvcyppvdtefdifg
    ngtyhpqt