PDB entry 2k0j

View 2k0j on RCSB PDB site
Description: Solution structure of CaM complexed to DRP1p
Class: metal binding protein
Keywords: calmodulin, DRP1 peptide, acetylation, calcium, methylation, phosphoprotein, ubl conjugation, structural Genomics, Structural proteomics in Europe, SPINE, metal binding protein
Deposited on 2008-02-04, released 2009-03-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-05-05, with a file datestamp of 2009-05-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Homo sapiens [TaxId:9606]
    Gene: Calm1, Calm, Cam, Cam1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62158 (1-147)
      • engineered (59)
    Domains in SCOPe 2.06: d2k0ja_
  • Heterogens: CA, LA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2k0jA (A:)
    adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgd
    gtidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdee
    vdemireadidgdgqvnyeefvqmmtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2k0jA (A:)
    dqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgdg
    tidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeev
    demireadidgdgqvnyeefvqmmtak