PDB entry 2k0b

View 2k0b on RCSB PDB site
Description: NMR structure of the UBA domain of p62 (SQSTM1)
Class: signaling protein
Keywords: ubiquitin binding, helical bundle, three helices, Alternative splicing, Apoptosis, Cytoplasm, Differentiation, Disease mutation, Endosome, Immune response, Metal-binding, Nucleus, Phosphoprotein, Polymorphism, Zinc, Zinc-finger, SIGNALING PROTEIN
Deposited on 2008-01-31, released 2008-02-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'X':
  Compound: Sequestosome-1
  Species: Homo sapiens [TaxId:9606]
  Gene: SQSTM1, ORCA, OSIL
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q13501 (2-51)
    • expression tag (0-1)
  Domains in SCOPe 2.06: d2k0bx2, d2k0bx3

PDB Chain Sequences:

• Chain 'X':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2k0bX (X:)
  gsppeadprlieslsqmlsmgfsdeggwltrllqtknydigaaldtiqyskh