PDB entry 2jzt

View 2jzt on RCSB PDB site
Description: Solution NMR structure of Q8ZP25_SALTY from Salmonella typhimurium. Northeast Structural Genomics Consortium target StR70
Class: isomerase
Keywords: NESG, StR70, Structural Genomics, Putative [NiFe] hydrogenase assembly, Chaperone, Isomerase, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium
Deposited on 2008-01-16, released 2008-02-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative thiol-disulfide isomerase and thioredoxin
    Species: Salmonella typhimurium LT2 [TaxId:99287]
    Gene: STM1790
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZP25 (0-133)
      • expression tag (134-141)
    Domains in SCOPe 2.06: d2jzta1, d2jzta2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jztA (A:)
    mandtpfsalwqrlltrgwqpveastvddwikrvgdgvillssdprrtpevsdnpvmiae
    llrefpqfdwqvavadleqseaigdrfnvrrfpatlvftdgklrgalsgihpwaelltlm
    rsivdtpaaqetvqlehhhhhh