PDB entry 2jz3

View 2jz3 on RCSB PDB site
Description: SOCS box elonginBC ternary complex
Class: transcription inhibitor/transcription
Keywords: socs proteins, elongins, cytokine signaling, Growth regulation, Phosphoprotein, SH2 domain, Signal transduction inhibitor, Ubl conjugation pathway, Nucleus, Transcription, Transcription regulation, signaling protein, TRANSCRIPTION INHIBITOR-TRANSCRIPTION COMPLEX
Deposited on 2007-12-27, released 2008-09-23
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-03-02, with a file datestamp of 2011-02-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Suppressor of cytokine signaling 3
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Transcription elongation factor B polypeptide 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2jz3b1
  • Chain 'C':
    Compound: Transcription elongation factor B polypeptide 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2jz3c1

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jz3B (B:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmkpqdsgssaneqavq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jz3C (C:)
    myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
    ftykvrytnssteipefpiapeialellmaanfldc