PDB entry 2jyq

View 2jyq on RCSB PDB site
Description: NMR structure of the apo v-Src SH2 domain
Class: transferase
Keywords: PROTEIN, SRC, SH2, src homology 2, ATP-binding, Kinase, Lipoprotein, Myristate, Nucleotide-binding, Oncogene, Phosphoprotein, SH2 domain, SH3 domain, Transferase, Tyrosine-protein kinase
Deposited on 2007-12-17, released 2008-06-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase transforming protein Src
    Species: Rous sarcoma virus [TaxId:11886]
    Gene: V-SRC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2jyqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2jyqA (A:)
qaeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyk
irkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcptsk