PDB entry 2jy7

View 2jy7 on RCSB PDB site
Description: NMR structure of the ubiquitin associated (UBA) domain of p62 (SQSTM1). RDC refined
Class: protein binding
Keywords: ubiquitin binding, ubiquitin associated domain, helical bundle, three helices, Alternative splicing, Apoptosis, Cytoplasm, Differentiation, Disease mutation, Endosome, Immune response, Metal-binding, Nucleus, Phosphoprotein, Polymorphism, Zinc, Zinc-finger, PROTEIN BINDING
Deposited on 2007-12-07, released 2007-12-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-binding protein p62
    Species: Homo sapiens [TaxId:9606]
    Gene: SQSTM1, ORCA, OSIL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13501 (2-51)
      • expression tag (0-1)
    Domains in SCOPe 2.03: d2jy7a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2jy7A (A:)
gsppeadprlieslsqmlsmgfsdeggwltrllqtknydigaaldtiqyskh