PDB entry 2jx2

View 2jx2 on RCSB PDB site
Description: Solution conformation of RNA-bound NELF-E RRM
Class: transcription
Keywords: nelfe-rrm, Coiled coil, Nucleus, Phosphorylation, Repressor, RNA-binding, Transcription, Transcription regulation, Ubl conjugation
Deposited on 2007-11-02, released 2008-04-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: negative elongation factor e
    Species: Homo sapiens [TaxId:9606]
    Gene: RDBP, NELFE, RD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2jx2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jx2A (A:)
    mgsshhhhhhssglvprgshmgpfrrsdsfperraprkgntlyvygedmtptllrgafsp
    fgniidlsmdpprncafvtyekmesadqavaelngtqvesvqlkvniarkqpmldaatgk
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jx2A (A:)
    aprkgntlyvygedmtptllrgafspfgniidlsmdpprncafvtyekmesadqavaeln
    gtqvesvqlkvniarkqpmldaatgks