PDB entry 2jwz

View 2jwz on RCSB PDB site
Description: Mutations in the hydrophobic core of ubiquitin differentially affect its recognition by receptor proteins
Class: signaling protein
Keywords: UBIQUITIN, NMR, L69S MUTANT, CORE MUTATION, Cytoplasm, DNA damage, DNA repair, Nucleus, Phosphorylation, Ubl conjugation, PROTEASOMAL DEGRADATION, SIGNALING PROTEIN
Deposited on 2007-10-31, released 2008-01-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ubiquitin
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: UBI1, RPL40A
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61864 (0-75)
    • engineered (68)
  Domains in SCOPe 2.03: d2jwza1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jwzA (A:)
  mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
  iqkestlhsvlrlrgg