PDB entry 2jw4

View 2jw4 on RCSB PDB site
Description: NMR solution structure of the N-terminal SH3 domain of human Nckalpha
Class: signaling protein
Keywords: SH3 domain, NMR, Cytoplasm, Phosphorylation, SH2 domain, SIGNALING PROTEIN
Deposited on 2007-10-05, released 2008-08-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-01-27, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytoplasmic protein nck1
  Species: Homo sapiens [TaxId:9606]
  Gene: NCK1, NCK
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16333 (3-65)
    • expression tag (0-2)
    • expression tag (66-71)
  Domains in SCOPe 2.06: d2jw4a1, d2jw4a2, d2jw4a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jw4A (A:)
  gstmaeevvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyve
  rknsaraaanss