PDB entry 2jw2

View 2jw2 on RCSB PDB site
Description: Validation of inter-helical orientation of the steril-alpha-motif of human deleted in liver cancer 2 by residual dipolar couplings
Class: lipid binding protein
Keywords: DLC2-SAM, RDC refinement, Alternative splicing, Anti-oncogene, Cell cycle, Cytoplasm, GTPase activation, Polymorphism, LIPID BINDING PROTEIN
Deposited on 2007-10-03, released 2008-10-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: StAR-related lipid transfer protein 13
  Species: Homo sapiens [TaxId:9606]
  Gene: DLC2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Y3M8 (16-80)
    • expression tag (0-15)
  Domains in SCOPe 2.05: d2jw2a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jw2A (A:)
  mhhhhhhssglvprgsqeieakeacdwlraagfpqyaqlyedsqfpinivavkndhdfle
  kdlveplcrrlntlnkcasmk