PDB entry 2jv9

View 2jv9 on RCSB PDB site
Description: The Solution Structure of Calponin Homology Domain from Smoothelin-like 1
Class: structural protein, protein binding
Keywords: CH-domain, Smoothelin, Smoothelin-like 1, Calponin, Calponin homology domain, STRUCTURAL PROTEIN, PROTEIN BINDING
Deposited on 2007-09-12, released 2008-05-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Smoothelin-like 1
    Species: MUS MUSCULUS
    Gene: Smtnl1, RP23-399J8.5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99LM3 (5-118)
      • expression tag (0-4)
    Domains in SCOPe 2.05: d2jv9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jv9A (A:)
    gplgsknmllewcramtrnyehvdiqnfssswssgmafcalihkffpeafdyaeldpakr
    rhnftlafstaekladcaqllevddmvrlavpdskcvytyiqelyrslvqkglvktkkk