PDB entry 2jul

View 2jul on RCSB PDB site
Description: NMR Structure of DREAM
Class: DNA binding protein
Keywords: EF-hand, calcium, LxxLL, DNA binding protein, dimer, Alternative splicing, Apoptosis, Cytoplasm, Endoplasmic reticulum, Golgi apparatus, Ion transport, Ionic channel, Lipoprotein, Membrane, Nucleus, Palmitate, Polymorphism, Potassium, Potassium channel, Potassium transport, Repressor, Transcription, Transcription regulation, Transport, Voltage-gated channel
Deposited on 2007-08-30, released 2008-04-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calsenilin
    Species: Mus musculus [TaxId:10090]
    Gene: Kcnip3, Csen, Dream, Kchip3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2jula_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2julA (A:)
    mqrtkeavkasdgnllgdpgriplskresikwqrprftrqalmrcclikwilssaapqgs
    dssdselelstvrhqpegldqlqaqtkftkkelqslyrgfknecptglvdedtfkliysq
    ffpqgdattyahflfnafdadgngaihfedfvvglsillrgtvheklkwafnlydinkdg
    citkeemlaimksiydmmgrhtypilredaplehverffqkmdrnqdgvvtidefletcq
    kdenimnsmqlfenvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2julA (A:)
    pegldqlqaqtkftkkelqslyrgfknecptglvdedtfkliysqffpqgdattyahflf
    nafdadgngaihfedfvvglsillrgtvheklkwafnlydinkdgcitkeemlaimksiy
    dmmgrhtypilredaplehverffqkmdrnqdgvvtidefletcqkdenimnsmqlfenv
    i