PDB entry 2jt4

View 2jt4 on RCSB PDB site
Description: Solution Structure of the Sla1 SH3-3-Ubiquitin Complex
Class: signaling protein
Keywords: endocytosis, monoubiquitin signaling, ubiquitin-binding motif, SH3, ubiquitin, Actin-binding, Cytoplasm, Cytoskeleton, Phosphorylation, SH3 domain, DNA damage, DNA repair, Nucleus, Ubl conjugation, SIGNALING PROTEIN
Deposited on 2007-07-18, released 2007-09-25
The last revision prior to the SCOP 1.75 freeze date was dated 2007-09-25, with a file datestamp of 2007-09-21.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytoskeleton assembly control protein SLA1
    Species: Saccharomyces cerevisiae
    Gene: SLA1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ubiquitin
    Species: Saccharomyces cerevisiae
    Gene: UBI1, RPL40A
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2jt4b1

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jt4B (B:)
    mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg