PDB entry 2jsc

View 2jsc on RCSB PDB site
Description: NMR structure of the cadmium metal-sensor CMTR from Mycobacterium tuberculosis
Class: transcription
Keywords: cadmium, transcriptional repressor, solution structure, structural genomics, structural proteomics in europe, spine, transcription
Deposited on 2007-07-02, released 2007-07-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator Rv1994c/MT2050
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv1994c, MT2050, MTCY39.25
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2jsca_
  • Chain 'B':
    Compound: Transcriptional regulator Rv1994c/MT2050
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv1994c, MT2050, MTCY39.25
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2jscb_
  • Heterogens: CD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jscA (A:)
    mltcemresalarlgraladptrcrilvalldgvcypgqlaahlgltrsnvsnhlsclrg
    cglvvatyegrqvryaladshlaralgelvqvvlavdtdqpcvaeraasgeavemtgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jscA (A:)
    larlgraladptrcrilvalldgvcypgqlaahlgltrsnvsnhlsclrgcglvvatyeg
    rqvryaladshlaralgelvqvvlavdtdqpcvaer
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jscB (B:)
    mltcemresalarlgraladptrcrilvalldgvcypgqlaahlgltrsnvsnhlsclrg
    cglvvatyegrqvryaladshlaralgelvqvvlavdtdqpcvaeraasgeavemtgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jscB (B:)
    alarlgraladptrcrilvalldgvcypgqlaahlgltrsnvsnhlsclrgcglvvatye
    grqvryaladshlaralgelvqvvlavdtdqpcvaer