PDB entry 2js0

View 2js0 on RCSB PDB site
Description: Solution structure of second SH3 domain of adaptor Nck
Class: signaling protein
Keywords: SH3 domain, adaptor, signaling, SIGNALING PROTEIN
Deposited on 2007-06-29, released 2008-02-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16333 (2-60)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d2js0a1, d2js0a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2js0A (A:)
    gslnmpayvkfnymaeredelslikgtkvivmekcsdgwwrgsyngqvgwfpsnyvteeg
    d