PDB entry 2jrl

View 2jrl on RCSB PDB site
Description: Solution structure of the beryllofluoride-activated NtrC4 receiver domain dimer
Class: transcription
Keywords: NTRC, NTRC4, RECEIVER DOMAIN, TRANSCRIPTION REGULATOR, DIMER, Structural Genomics, Berkeley Structural Genomics Center, BSGC, TRANSCRIPTION
Deposited on 2007-06-27, released 2008-07-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: transcriptional regulator (NtrC family)
  Species: Aquifex aeolicus
  Gene: ntrC4, aq_164
  Database cross-references and differences (RAF-indexed):
  • Uniprot O66551 (0-120)
  Domains in SCOPe 2.06: d2jrla_
• Chain 'B':
  Compound: transcriptional regulator (NtrC family)
  Species: Aquifex aeolicus
  Gene: ntrC4, aq_164
  Database cross-references and differences (RAF-indexed):
  • Uniprot O66551 (0-120)
  Domains in SCOPe 2.06: d2jrlb_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jrlA (A:)
  mkrvlvvddeesitsslsaileeegyhpdtaktlreaekkikelffpvivldvwmpdgdg
  vnfidfikenspdsvvivitghgsvdtavkaikkgayeflekpfsverflltikhafeey
  s
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jrlB (B:)
  mkrvlvvddeesitsslsaileeegyhpdtaktlreaekkikelffpvivldvwmpdgdg
  vnfidfikenspdsvvivitghgsvdtavkaikkgayeflekpfsverflltikhafeey
  s