PDB entry 2jrl

View 2jrl on RCSB PDB site
Description: Solution structure of the beryllofluoride-activated NtrC4 receiver domain dimer
Class: transcription
Keywords: NTRC, NTRC4, RECEIVER DOMAIN, TRANSCRIPTION REGULATOR, DIMER, Structural Genomics, Berkeley Structural Genomics Center, BSGC, TRANSCRIPTION
Deposited on 2007-06-27, released 2008-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional regulator (NtrC family)
    Species: Aquifex aeolicus
    Gene: ntrC4, aq_164
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jrla_
  • Chain 'B':
    Compound: transcriptional regulator (NtrC family)
    Species: Aquifex aeolicus
    Gene: ntrC4, aq_164
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jrlb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jrlA (A:)
    mkrvlvvddeesitsslsaileeegyhpdtaktlreaekkikelffpvivldvwmpdgdg
    vnfidfikenspdsvvivitghgsvdtavkaikkgayeflekpfsverflltikhafeey
    s
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jrlB (B:)
    mkrvlvvddeesitsslsaileeegyhpdtaktlreaekkikelffpvivldvwmpdgdg
    vnfidfikenspdsvvivitghgsvdtavkaikkgayeflekpfsverflltikhafeey
    s