PDB entry 2jqm

View 2jqm on RCSB PDB site
Description: Yellow Fever Envelope Protein Domain III NMR Structure (S288-K398)
Class: transferase
Keywords: Yellow Fever Envelope Protein Domain III, Asibi strain, NMR structure, TRANSFERASE
Deposited on 2007-06-03, released 2008-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-11-17, with a file datestamp of 2009-11-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Envelope protein E
  Species: Yellow fever virus
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6J3P1 (0-111)
    • engineered (0)
  Domains in SCOPe 2.08: d2jqma_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jqmA (A:)
  msaltlkgtsykmctdkmsfvknptdtghgtvvmqvkvpkgapckipvivaddltaaink
  gilvtvnpiastnddevlievnppfgdsyiivgtgdsrltyqwhkegssigk