PDB entry 2jqa

View 2jqa on RCSB PDB site
Description: Solution structure of apo-DR1885 from Deinococcus radiodurans
Class: metal binding protein
Keywords: copper binding protein, metal binding protein
Deposited on 2007-05-30, released 2007-06-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Gene: DR1885
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RT80 (1-144)
      • cloning artifact (0)
      • cloning artifact (145-148)
    Domains in SCOPe 2.06: d2jqaa1, d2jqaa2, d2jqaa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2jqaA (A:)
mghtmpahtppaqtapaaqkagaqalpvtvqgatvaavppsirdtaaymtltnksdqpik
lvgaatplatspmlmttthsggmagmkmvpwltipargtltlqrdgdhvmlmglkrplkv
getvnitlkatdgrtlnvaatvkkniegr