PDB entry 2jq7

View 2jq7 on RCSB PDB site
Description: Model for thiostrepton binding to the ribosomal L11-RNA
Class: ribosome/antibiotic
Keywords: ribosome-antibiotic complex, thiopeptide, antibacterial, thiazole, thiazoline, oxazole, ribosome, l11, translation inhibition
Deposited on 2007-05-30, released 2007-07-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50S ribosomal protein L11
    Species: Thermotoga maritima [TaxId:2336]
    Gene: rplK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2jq7a1
  • Chain 'B':
    Compound: ribosomal RNA
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: thiostrepton
    Species: STREPTOMYCES AZUREUS [TaxId:146537]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jq7A (A:)
    makkvaaqiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitv
    yedksftfiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnans
    leaamkiiegtaksmgievvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jq7A (A:)
    qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
    fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
    iegtaksmgievvd
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.