PDB entry 2jnu

View 2jnu on RCSB PDB site
Description: Solution structure of the RGS domain of human RGS14
Class: signaling protein
Keywords: Regulator of G-protein signalling domain, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
Deposited on 2007-02-02, released 2007-02-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: regulator of g-protein signaling 14
    Species: Homo sapiens [TaxId:9606]
    Gene: RGS14
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43566 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.04: d2jnua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2jnuA (A:)
smteeqpvaswalsferllqdplglayfteflkkefsaenvtfwkacerfqqipasdtqq
laqearniyqeflssqalspvnidrqawlgeevlaeprpdmfraqqlqifnlmkfdsyar
fvksplyrecllaeaegrplrepgssrlgspdat

    Sequence, based on observed residues (ATOM records): (download) 
    >2jnuA (A:)
smteeqpvaswalsferllqdplglayfteflkkefsaenvtfwkacerfqqipasdtqq
laqearniyqeflssqalspvnidrqawlgeevlaeprpdmfraqqlqifnlmkfdsyar
fvksplyrecllaeae