PDB entry 2jnf

View 2jnf on RCSB PDB site
Description: Solution structure of fly troponin C, isoform F1
Class: metal binding protein
Keywords: Stretch Activated Muscle Contraction, Troponin C, EF-hand, lethocerus indicus, METAL BINDING PROTEIN
Deposited on 2007-01-18, released 2007-08-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: troponin c
  Species: Lethocerus indicus [TaxId:212017]
  Gene: tnC4
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q868D4 (0-157)
  Domains in SCOPe 2.08: d2jnfa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jnfA (A:)
  mgdvsklssnqvklletafrdfetpegsgrvstdqigiilevlgiqqtkstirqlidefd
  pfgngdidfdsfkiigarflgeevnpeqmqqelreafrlydkegngyistdvmreilael
  detlssedldamideidadgsgtvdfeefmgvmtggde