PDB entry 2jnb

View 2jnb on RCSB PDB site
Description: Solution Structure of RNA-binding protein 15.5K
Class: RNA binding protein
Keywords: splicing, kink-turn RNA-binding protein, nhpx, RNA BINDING PROTEIN
Deposited on 2007-01-04, released 2007-12-18
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NHP2-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NHP2L1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2jnba1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jnbA (A:)
    mghhhhhhssgieegrmteadvnpkaypladahltkklldlvqqscnykqlrkganeatk
    tlnrgisefivmaadaepleiilhlpllcedknvpyvfvrskqalgracgvsrpviacsv
    tikegsqlkqqiqsiqqsierllv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jnbA (A:)
    mteadvnpkaypladahltkklldlvqqscnykqlrkganeatktlnrgisefivmaada
    epleiilhlpllcedknvpyvfvrskqalgracgvsrpviacsvtikegsqlkqqiqsiq
    qsierllv