PDB entry 2jma

View 2jma on RCSB PDB site
Description: R21A Spc-SH3:P41 complex
Class: structural protein
Keywords: SH3 domain, p41-bound, STRUCTURAL PROTEIN
Deposited on 2006-10-25, released 2007-04-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spectrin alpha chain, brain
    Species: Gallus gallus [TaxId:9031]
    Gene: SPTAN1, SPTA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07751 (1-61)
      • cloning artifact (0)
      • engineered (20)
    Domains in SCOPe 2.06: d2jmaa1, d2jmaa2
  • Chain 'B':
    Compound: P41 peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 2JMA (Start-9)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2jmaA (A:)
mdetgkelvlalydyqekspaevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkk
ld

  • Chain 'B':
    No sequence available.