PDB entry 2jly

View 2jly on RCSB PDB site
Description: dengue virus 4 ns3 helicase in complex with ssrna and ADP-phosphate
Class: hydrolase/RNA
Keywords: hydrolase-RNA complex, envelope protein, ribonucleoprotein, capsid protein, RNA replication, serine protease, glycoprotein, dengue virus, metal-binding, transferase, ATP-binding, RNA-binding, flaviviruses, transcription regulation, RNA-directed RNA polymerase, nucleotide-binding, viral nucleoprotein, secreted, helicase, protease, hydrolase, phosphate, cleavage on pair of basic residues, endoplasmic reticulum, nucleotidyltransferase, ADP, ssrna, virion, ATPase, nucleus, membrane, transmembrane, transcription, phosphoprotein, ns3 helicase structure, multifunctional enzyme
Deposited on 2008-09-15, released 2008-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.20194
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine protease subunit ns3
    Species: DENGUE VIRUS 4 [TaxId:408688]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JLY (0-3)
      • conflict (45)
      • conflict (82)
      • conflict (124)
      • conflict (153)
      • conflict (213)
      • conflict (312)
    • Uniprot Q2YHF0 (4-450)
    Domains in SCOPe 2.07: d2jlya1, d2jlya2, d2jlya3
  • Chain 'B':
    Compound: serine protease subunit ns3
    Species: DENGUE VIRUS 4 [TaxId:408688]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JLY (0-3)
      • conflict (45)
      • conflict (82)
      • conflict (124)
      • conflict (153)
      • conflict (213)
      • conflict (312)
    • Uniprot Q2YHF0 (4-450)
    Domains in SCOPe 2.07: d2jlyb1, d2jlyb2, d2jlyb3
  • Chain 'C':
    Compound: 5'-r(*ap*gp*ap*cp*up*ap*ap*cp*ap*ap*cp*u)-3'
  • Chain 'D':
    Compound: 5'-r(*ap*gp*ap*cp*up*ap*ap*cp*ap*ap*cp*u)-3'
  • Heterogens: ADP, PO4, MN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jlyA (A:)
    gsamgepdyevdedifrkkrltimdlhpgagktkrilpsivreallrrlrtlilaptrvv
    aaemeealrglpiryqtpavksdhtgreivdlmchatfttrllsstrvpnynlivmdeah
    ftdpcsvaargyistrvemgeaaaifmtatppgstdpfpqsnspiediereiperswntg
    fdwitdyqgktvwfvpsikagndianclrksgkrviqlsrktfdteypktkltdwdfvvt
    tdisemganfragrvidprrclkpviltdgpervilagpipvtpasaaqrrgrigrnpaq
    eddqyvfsgdplkndedhahwteakmlldniytpegiiptlfgperektqaidgefrlrg
    eqrktfvelmrrgdlpvwlsykvasagisykdrewcftgernnqileenmeveiwtrege
    kkklrpkwldarvyadpmalkdfkefasgrk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jlyB (B:)
    gsamgepdyevdedifrkkrltimdlhpgagktkrilpsivreallrrlrtlilaptrvv
    aaemeealrglpiryqtpavksdhtgreivdlmchatfttrllsstrvpnynlivmdeah
    ftdpcsvaargyistrvemgeaaaifmtatppgstdpfpqsnspiediereiperswntg
    fdwitdyqgktvwfvpsikagndianclrksgkrviqlsrktfdteypktkltdwdfvvt
    tdisemganfragrvidprrclkpviltdgpervilagpipvtpasaaqrrgrigrnpaq
    eddqyvfsgdplkndedhahwteakmlldniytpegiiptlfgperektqaidgefrlrg
    eqrktfvelmrrgdlpvwlsykvasagisykdrewcftgernnqileenmeveiwtrege
    kkklrpkwldarvyadpmalkdfkefasgrk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.