PDB entry 2jlv

View 2jlv on RCSB PDB site
Description: dengue virus 4 ns3 helicase in complex with ssrna and amppnp
Class: hydrolase/RNA
Keywords: hydrolase-RNA complex, ribonucleoprotein, nucleotide-binding, helicase, protease, hydrolase, ATP analog, transferase, viral nucleoprotein, endoplasmic reticulum, cleavage on pair of basic residues, ssrna, virion, ATPase, nucleus, membrane, secreted, multifunctional enzyme, transcription regulation, nucleotidyltransferase, ns3 helicase structure, ATP-binding, RNA-binding, flaviviruses, glycoprotein, RNA-directed RNA polymerase, RNA replication, serine protease, envelope protein, dengue virus, metal-binding, transmembrane, transcription, phosphoprotein, capsid protein
Deposited on 2008-09-15, released 2008-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.19349
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine protease subunit ns3
    Species: DENGUE VIRUS 4 [TaxId:408688]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JLV (0-3)
      • conflict (82)
      • conflict (124)
      • conflict (153-154)
      • conflict (213)
      • conflict (312)
    • Uniprot Q2YHF0 (4-450)
    Domains in SCOPe 2.07: d2jlva1, d2jlva2, d2jlva3
  • Chain 'B':
    Compound: serine protease subunit ns3
    Species: DENGUE VIRUS 4 [TaxId:408688]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JLV (0-3)
      • conflict (82)
      • conflict (124)
      • conflict (153-154)
      • conflict (213)
      • conflict (312)
    • Uniprot Q2YHF0 (4-450)
    Domains in SCOPe 2.07: d2jlvb1, d2jlvb2, d2jlvb3
  • Chain 'C':
    Compound: 5'-r(*ap*gp*ap*cp*up*ap*ap*cp*ap*ap*cp*u)-3'
  • Chain 'D':
    Compound: 5'-r(*ap*gp*ap*cp*up*ap*ap*cp*ap*ap*cp*u)-3'
  • Heterogens: ANP, MN, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jlvA (A:)
    gsamgepdyevdedifrkkrltimdlhpgagktkrilpsivrealkrrlrtlilaptrvv
    aaemeealrglpiryqtpavksdhtgreivdlmchatfttrllsstrvpnynlivmdeah
    ftdpcsvaargyistrvemgeaaaifmtatppgsidpfpqsnspiediereiperswntg
    fdwitdyqgktvwfvpsikagndianclrksgkrviqlsrktfdteypktkltdwdfvvt
    tdisemganfragrvidprrclkpviltdgpervilagpipvtpasaaqrrgrigrnpaq
    eddqyvfsgdplkndedhahwteakmlldniytpegiiptlfgperektqaidgefrlrg
    eqrktfvelmrrgdlpvwlsykvasagisykdrewcftgernnqileenmeveiwtrege
    kkklrpkwldarvyadpmalkdfkefasgrk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jlvB (B:)
    gsamgepdyevdedifrkkrltimdlhpgagktkrilpsivrealkrrlrtlilaptrvv
    aaemeealrglpiryqtpavksdhtgreivdlmchatfttrllsstrvpnynlivmdeah
    ftdpcsvaargyistrvemgeaaaifmtatppgsidpfpqsnspiediereiperswntg
    fdwitdyqgktvwfvpsikagndianclrksgkrviqlsrktfdteypktkltdwdfvvt
    tdisemganfragrvidprrclkpviltdgpervilagpipvtpasaaqrrgrigrnpaq
    eddqyvfsgdplkndedhahwteakmlldniytpegiiptlfgperektqaidgefrlrg
    eqrktfvelmrrgdlpvwlsykvasagisykdrewcftgernnqileenmeveiwtrege
    kkklrpkwldarvyadpmalkdfkefasgrk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.