PDB entry 2jls

View 2jls on RCSB PDB site
Description: dengue virus 4 ns3 helicase in complex with ADP
Class: hydrolase
Keywords: ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, protease, hydrolase, transferase, cleavage on pair of basic residues, multifunctional enzyme, transcription regulation, nucleotidyltransferase, ns3 helicase structure, ADP, virion, ATPase, nucleus, membrane, secreted, ATP-binding, RNA-binding, flaviviruses, glycoprotein, RNA-directed RNA polymerase, RNA replication, serine protease, envelope protein, dengue virus, metal-binding, transmembrane, transcription, phosphoprotein, capsid protein
Deposited on 2008-09-15, released 2008-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.1883
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine protease subunit ns3
    Species: DENGUE VIRUS 4 [TaxId:408688]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JLS
      • conflict (82)
      • conflict (124)
      • conflict (153)
      • conflict (213)
      • conflict (312)
    • Uniprot Q2YHF0 (Start-450)
    Domains in SCOPe 2.07: d2jlsa1, d2jlsa2
  • Heterogens: MN, ADP, BME, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jlsA (A:)
    gsamgepdyevdedifrkkrltimdlhpgagktkrilpsivrealkrrlrtlilaptrvv
    aaemeealrglpiryqtpavksdhtgreivdlmchatfttrllsstrvpnynlivmdeah
    ftdpcsvaargyistrvemgeaaaifmtatppgstdpfpqsnspiediereiperswntg
    fdwitdyqgktvwfvpsikagndianclrksgkrviqlsrktfdteypktkltdwdfvvt
    tdisemganfragrvidprrclkpviltdgpervilagpipvtpasaaqrrgrigrnpaq
    eddqyvfsgdplkndedhahwteakmlldniytpegiiptlfgperektqaidgefrlrg
    eqrktfvelmrrgdlpvwlsykvasagisykdrewcftgernnqileenmeveiwtrege
    kkklrpkwldarvyadpmalkdfkefasgrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jlsA (A:)
    yevdedifrkkrltimdlhpgagktkrilpsivrealkrrlrtlilaptrvvaaemeeal
    rglpiryqtpavksdhtgreivdlmchatfttrllsstrvpnynlivmdeahftdpcsva
    argyistrvemgeaaaifmtatppgstdpfpqsnspiediereiperswntgfdwitdyq
    gktvwfvpsikagndianclrksgkrviqlsrktfdteypktkltdwdfvvttdisemga
    nfragrvidprrclkpviltdgpervilagpipvtpasaaqrrgrigrnpaqeddqyvfs
    gdplkndedhahwteakmlldniytpegiiptlfgperektqaidgefrlrgeqrktfve
    lmrrgdlpvwlsykvasagisykdrewcftgernnqileenmeveiwtregekkklrpkw
    ldarvyadpmalkdfkefasgrk