PDB entry 2jl3

View 2jl3 on RCSB PDB site
Description: crystal structure of the cu metallated h254f mutant of alcaligenes xylosoxidans cu nitrite reductase
Class: oxidoreductase
Keywords: denitrification, oxidoreductase, catalysis, proton channel
Deposited on 2008-09-02, released 2008-12-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-05-18, with a file datestamp of 2011-05-13.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.175
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dissimilatory copper-containing nitrite reductase
    Species: ACHROMOBACTER XYLOSOXIDANS [TaxId:85698]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O68601
      • engineered mutation (253)
    Domains in SCOPe 2.06: d2jl3a1, d2jl3a2
  • Chain 'B':
    Compound: dissimilatory copper-containing nitrite reductase
    Species: ACHROMOBACTER XYLOSOXIDANS [TaxId:85698]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O68601
      • engineered mutation (253)
    Domains in SCOPe 2.06: d2jl3b1, d2jl3b2
  • Heterogens: CU, ZN, MES, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jl3A (A:)
    qdadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfng
    smpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfka
    drsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdpqgkplhydraytigefdlyip
    kgpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihs
    qanrdtrphliggfgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnh
    nlieafelgaaghikvegkwnddlmkqikapapipr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jl3A (A:)
    adklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngsm
    pgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkadr
    sgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdpqgkplhydraytigefdlyipkg
    pdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihsqa
    nrdtrphliggfgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnhnl
    ieafelgaaghikvegkwnddlmkqikapapip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jl3B (B:)
    qdadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfng
    smpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfka
    drsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdpqgkplhydraytigefdlyip
    kgpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihs
    qanrdtrphliggfgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnh
    nlieafelgaaghikvegkwnddlmkqikapapipr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jl3B (B:)
    adklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngsm
    pgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkadr
    sgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdpqgkplhydraytigefdlyipkg
    pdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihsqa
    nrdtrphliggfgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnhnl
    ieafelgaaghikvegkwnddlmkqikapapip