PDB entry 2jk1

View 2jk1 on RCSB PDB site
Description: crystal structure of the wild-type hupr receiver domain
Class: DNA-binding
Keywords: nucleotide-binding, transcription regulation, beryllium fluoride phosphorylation mimic, hupr, activator, ATP-binding, DNA-binding, two-component regulatory system, transcription, phosphoprotein, response regulator
Deposited on 2008-05-26, released 2008-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.22473
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hydrogenase transcriptional regulatory protein hupr1
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26408 (Start-135)
    • PDB 2JK1 (136-138)
    Domains in SCOPe 2.07: d2jk1a_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jk1A (A:)
    apaillvddephslaamklaleddfdvltaqgaeaaiaileeewvqviicdqrmpgrtgv
    dfltevrerwpetvriiitgytdsasmmaaindagihqfltkpwhpeqllssarnaarmf
    tlarenerlslemrllerp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jk1A (A:)
    paillvddephslaamklaleddfdvltaqgaeaaiaileeewvqviicdqrmpgrtgvd
    fltevrerwpetvriiitgytdsasmmaaindagihqfltkpwhpeqllssarnaarmft
    larenerlslemrllerp