PDB entry 2jjt

View 2jjt on RCSB PDB site
Description: structure of human cd47 in complex with human signal regulatory protein (sirp) alpha
Class: cell adhesion
Keywords: signal regulatory protein alpha, immunoglobulin superfamily, transmembrane, phosphoprotein, paired receptor, polymorphism, glycoprotein, cell adhesion, pyrrolidone carboxylic acid, alternative splicing, immunoglobulin domain, sirp, cd47, sirpa, membrane, sh3-binding
Deposited on 2008-04-22, released 2008-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.238
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-protein phosphatase non-receptor type substrate 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jjta_
  • Chain 'B':
    Compound: tyrosine-protein phosphatase non-receptor type substrate 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jjtb_
  • Chain 'C':
    Compound: leukocyte surface antigen cd47
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08722 (0-End)
      • engineered mutation (14)
  • Chain 'D':
    Compound: leukocyte surface antigen cd47
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08722 (0-End)
      • engineered mutation (14)
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jjtA (A:)
    eeelqviqpdksvsvaagesailhctvtslipvgpiqwfrgagpareliynqkeghfprv
    ttvsestkrenmdfsisisnitpadagtyycvkfrkgspdtefksgagtelsvrakpstr
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jjtA (A:)
    elqviqpdksvsvaagesailhctvtslipvgpiqwfrgagpareliynqkeghfprvtt
    vsestkrenmdfsisisnitpadagtyycvkfrkgspdtefksgagtelsvra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jjtB (B:)
    eeelqviqpdksvsvaagesailhctvtslipvgpiqwfrgagpareliynqkeghfprv
    ttvsestkrenmdfsisisnitpadagtyycvkfrkgspdtefksgagtelsvrakpstr
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jjtB (B:)
    eelqviqpdksvsvaagesailhctvtslipvgpiqwfrgagpareliynqkeghfprvt
    tvsestkrenmdfsisisnitpadagtyycvkfrkgspdtefksgagtelsvra
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.