PDB entry 2jj3

View 2jj3 on RCSB PDB site
Description: estrogen receptor beta ligand binding domain in complex with a benzopyran agonist
Class: transcription
Keywords: phosphorylation, steroid-binding, nuclear receptor, transcription regulation, alternative splicing, ligand binding domain, zinc, nucleus, receptor, zinc-finger, DNA-binding, transcription, metal-binding, lipid-binding
Deposited on 2007-07-03, released 2007-08-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.235
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2jj3a_
  • Chain 'B':
    Compound: Estrogen receptor beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2jj3b_
  • Heterogens: JJ3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jj3A (A:)
    mhhhhhhrellldalspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvh
    miswakkipgfvelslfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegk
    cvegileifdmllattsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklah
    llnavtdalvwviaksgissqqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvy
    dlllemlnahvlrgcks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jj3A (A:)
    dalspeqlvltlleaepphvlisrpasmmmsltkladkelvhmiswakkipgfvelslfd
    qvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmllattsr
    frelklqhkeylcvkamillnssmyplvssrklahllnavtdalvwviaksgissqqqsm
    rlanllmllshvrhasnkgmehllnmknvvpvydlllemlnahv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jj3B (B:)
    mhhhhhhrellldalspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvh
    miswakkipgfvelslfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegk
    cvegileifdmllattsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklah
    llnavtdalvwviaksgissqqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvy
    dlllemlnahvlrgcks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jj3B (B:)
    ldalspeqlvltlleaepphvlisrpasmmmsltkladkelvhmiswakkipgfvelslf
    dqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmllatts
    rfrelklqhkeylcvkamillnssmyplvssrklahllnavtdalvwviaksgissqqqs
    mrlanllmllshvrhasnkgmehllnmknvvpvydlllemlnahvlr