PDB entry 2jj2

View 2jj2 on RCSB PDB site
Description: the structure of f1-ATPase inhibited by quercetin.
Class: hydrolase
Keywords: alternative splicing, hydrogen ion transport, ion transport, mitochondrion, ATP synthesis, f1-ATPase, hydrolysis, acetylation, ATP-binding, pyrrolidone carboxylic acid, mitochondrial, transit peptide, nucleotide-binding, cf(1), bovine, hydrolase, transport, quercetin
Deposited on 2007-07-03, released 2007-08-21
The last revision prior to the SCOP 1.75 freeze date was dated 2007-09-04, with a file datestamp of 2007-08-31.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.19043
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ATP synthase subunit alpha heart isoform
  Species: BOS TAURUS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19483 (Start-509)
• Chain 'B':
  Compound: ATP synthase subunit alpha heart isoform
  Species: BOS TAURUS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19483
• Chain 'C':
  Compound: ATP synthase subunit alpha heart isoform
  Species: BOS TAURUS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19483 (Start-509)
• Chain 'D':
  Compound: ATP synthase subunit beta
  Species: BOS TAURUS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00829
• Chain 'E':
  Compound: ATP synthase subunit beta
  Species: BOS TAURUS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00829
• Chain 'F':
  Compound: ATP synthase subunit beta
  Species: BOS TAURUS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00829
• Chain 'G':
  Compound: ATP synthase gamma chain
  Species: BOS TAURUS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05631 (0-271)
  Domains in SCOP 1.75: d2jj2g1
• Chain 'H':
  Compound: ATP synthase subunit alpha heart isoform
  Species: BOS TAURUS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19483 (Start-509)
• Chain 'I':
  Compound: ATP synthase subunit alpha heart isoform
  Species: BOS TAURUS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19483
• Chain 'J':
  Compound: ATP synthase subunit alpha heart isoform
  Species: BOS TAURUS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19483 (Start-509)
• Chain 'K':
  Compound: ATP synthase subunit beta
  Species: BOS TAURUS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00829
• Chain 'L':
  Compound: ATP synthase subunit beta
  Species: BOS TAURUS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00829
• Chain 'M':
  Compound: ATP synthase subunit beta
  Species: BOS TAURUS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00829
• Chain 'N':
  Compound: ATP synthase gamma chain
  Species: BOS TAURUS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05631 (0-271)
  Domains in SCOP 1.75: d2jj2n1
• Heterogens: MG, AZI, PO4, ANP, ADP, QUE, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  Sequence, based on SEQRES records: (download)
  

  >2jj2G (G:)
  atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp
  edkkkhliigvssdrglcgaihssvakqmkseaanlaaagkevkiigvgdkirsilhrth
  sdqflvtfkevgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifs
  ldtissaesmsiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknas
  emidkltltfnrtrqavitkelieiisgaaal
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2jj2G (G:)
  atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgssdrglcgaihss
  vakqmigvgdkirsikevgrrpptfgdifnrfrsvisykteyslaniiyyslkesttseq
  sarmtamdnasknasemidkltltfnrtrqavitkelieiisgaaal
  

  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.
  
  
• Chain 'M':
  No sequence available.
  
  
• Chain 'N':
  Sequence, based on SEQRES records: (download)
  

  >2jj2N (N:)
  atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp
  edkkkhliigvssdrglcgaihssvakqmkseaanlaaagkevkiigvgdkirsilhrth
  sdqflvtfkevgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifs
  ldtissaesmsiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknas
  emidkltltfnrtrqavitkelieiisgaaal
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2jj2N (N:)
  atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgssdrglcgaihss
  vakqmigvgdkirsikevgrrpptfgdifnrfrsvisykteyslaniiyyslkesttseq
  sarmtamdnasknasemidkltltfnrtrqavitkelieiisgaaal