PDB entry 2jj0

View 2jj0 on RCSB PDB site
Description: photosynthetic reaction center mutant with ala m248 replaced with trp (chain m, am248w)
Class: photosynthesis
Keywords: photosynthesis, reaction center, membrane protein, photosynthetic reaction center, electron transport, bacteriochlorophyll, chlorophyll, metal-binding, transmembrane, iron, membrane, transport, magnesium, chromophore
Deposited on 2007-07-03, released 2007-09-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.205
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: reaction center protein h chain
    Species: RHODOBACTER SPHAEROIDES [TaxId:1063]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2jj0h1, d2jj0h2
  • Chain 'L':
    Compound: reaction center protein l chain
    Species: RHODOBACTER SPHAEROIDES [TaxId:1063]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2jj0l_
  • Chain 'M':
    Compound: reaction center protein m chain
    Species: RHODOBACTER SPHAEROIDES [TaxId:1063]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2JJ0
      • engineered mutation (248)
    • Uniprot P0C0Y9
    Domains in SCOPe 2.06: d2jj0m_
  • Heterogens: BCL, BPH, U10, CDL, FE, SPN, CL, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2jj0H (H:)
    mvgvtafgnfdlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpk
    pktfilphgrgtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdl
    peldghghnkikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarfle
    velkdgstrllpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagg
    lmyaapkrksvvaamlaeya
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jj0H (H:)
    dlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpkpktfilphgr
    gtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdlpeldghghnk
    ikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarflevelkdgstrl
    lpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagglmyaa
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jj0L (L:)
    allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
    pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
    fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
    ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
    vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2jj0M (M:)
    maeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvls
    lfsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwlias
    ffmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygi
    fshldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqia
    drgtaaerwalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgq
    nhgmapln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jj0M (M:)
    eyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslf
    sglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasff
    mfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifs
    hldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadr
    gtaaerwalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnh
    g