PDB entry 2jiy

View 2jiy on RCSB PDB site
Description: photosynthetic reaction center mutant with ala m149 replaced with trp (chain m, am149w)
Class: photosynthesis
Keywords: photosynthesis, membrane protein, electron transport, bacteriochlorophyll, chlorophyll, metal-binding, transport, chromophore
Deposited on 2007-07-03, released 2007-09-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.183
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: reaction center protein h chain
    Species: RHODOBACTER SPHAEROIDES [TaxId:1063]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2jiyh1, d2jiyh2
  • Chain 'L':
    Compound: reaction center protein l chain
    Species: RHODOBACTER SPHAEROIDES [TaxId:1063]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2jiyl_
  • Chain 'M':
    Compound: reaction center protein m chain
    Species: RHODOBACTER SPHAEROIDES [TaxId:1063]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C0Y9
      • engineered mutation (149)
    Domains in SCOPe 2.06: d2jiym_
  • Heterogens: LDA, BCL, BPH, U10, CDL, FE, PO4, SPN, CL, D12, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2jiyH (H:)
    mvgvtafgnfdlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpk
    pktfilphgrgtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdl
    peldghghnkikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarfle
    velkdgstrllpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagg
    lmyaapkrksvvaamlaeya
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jiyH (H:)
    dlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpkpktfilphgr
    gtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdlpeldghghnk
    ikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarflevelkdgstrl
    lpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagglmyaapkrks
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jiyL (L:)
    allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
    pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
    fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
    ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
    vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2jiyM (M:)
    maeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvls
    lfsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwlias
    ffmfvavwswwgrtylraqalgmgkhtawwflsaiwlwmvlgfirpilmgswseavpygi
    fshldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqia
    drgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgq
    nhgmapln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jiyM (M:)
    eyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslf
    sglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasff
    mfvavwswwgrtylraqalgmgkhtawwflsaiwlwmvlgfirpilmgswseavpygifs
    hldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadr
    gtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnh
    g