PDB entry 2jif

View 2jif on RCSB PDB site
Description: structure of human short-branched chain acyl-coa dehydrogenase (acadsb)
Class: oxidoreductase
Keywords: mitochondrion, oxidoreductase, transit peptide, fatty acid metabolism, fad, flavoprotein, disease mutation, lipid metabolism
Deposited on 2007-02-28, released 2007-04-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: short/branched chain specific acyl-coa dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JIF
    • Uniprot P45954 (23-403)
    Domains in SCOPe 2.06: d2jifa1, d2jifa2
  • Chain 'B':
    Compound: short/branched chain specific acyl-coa dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JIF
    • Uniprot P45954 (Start-403)
    Domains in SCOPe 2.06: d2jifb1, d2jifb2
  • Chain 'C':
    Compound: short/branched chain specific acyl-coa dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JIF
    • Uniprot P45954 (Start-403)
    Domains in SCOPe 2.06: d2jifc1, d2jifc2
  • Chain 'D':
    Compound: short/branched chain specific acyl-coa dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JIF
    • Uniprot P45954 (23-403)
    Domains in SCOPe 2.06: d2jifd1, d2jifd2
  • Heterogens: FAD, COS, EDO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jifA (A:)
    mhhhhhhssgvdlgtenlyfqsmaplqtftdeemmikssvkkfaqeqiaplvstmdensk
    meksviqglfqqglmgievdpeyggtgasflstvlvieelakvdasvavfceiqntlint
    lirkhgteeqkatylpqlttekvgsfclseagagsdsfalktradkegdyyvlngskmwi
    ssaehaglflvmanvdptigykgitsflvdrdtpglhigkpenklglrasstcpltfenv
    kvpeanilgqighgykyaigslnegrigiaaqmlglaqgcfdytipyikeriqfgkrlfd
    fqglqhqvahvatqleaarlltynaarlleagkpfikeasmakyyaseiagqttskciew
    mggvgytkdypvekyfrdakigtiyegasniqlntiakhidaey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jifA (A:)
    aplqtftdeemmikssvkkfaqeqiaplvstmdenskmeksviqglfqqglmgievdpey
    ggtgasflstvlvieelakvdasvavfceiqntlintlirkhgteeqkatylpqlttekv
    gsfclseagagsdsfalktradkegdyyvlngskmwissaehaglflvmanvdptigykg
    itsflvdrdtpglhigkpenklglrasstcpltfenvkvpeanilgqighgykyaigsln
    egrigiaaqmlglaqgcfdytipyikeriqfgkrlfdfqglqhqvahvatqleaarllty
    naarlleagkpfikeasmakyyaseiagqttskciewmggvgytkdypvekyfrdakigt
    iyegasniqlntiakhidaey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jifB (B:)
    mhhhhhhssgvdlgtenlyfqsmaplqtftdeemmikssvkkfaqeqiaplvstmdensk
    meksviqglfqqglmgievdpeyggtgasflstvlvieelakvdasvavfceiqntlint
    lirkhgteeqkatylpqlttekvgsfclseagagsdsfalktradkegdyyvlngskmwi
    ssaehaglflvmanvdptigykgitsflvdrdtpglhigkpenklglrasstcpltfenv
    kvpeanilgqighgykyaigslnegrigiaaqmlglaqgcfdytipyikeriqfgkrlfd
    fqglqhqvahvatqleaarlltynaarlleagkpfikeasmakyyaseiagqttskciew
    mggvgytkdypvekyfrdakigtiyegasniqlntiakhidaey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jifB (B:)
    tftdeemmikssvkkfaqeqiaplvstmdenskmeksviqglfqqglmgievdpeyggtg
    asflstvlvieelakvdasvavfceiqntlintlirkhgteeqkatylpqlttekvgsfc
    lseagagsdsfalktradkegdyyvlngskmwissaehaglflvmanvdptigykgitsf
    lvdrdtpglhigkpenklglrasstcpltfenvkvpeanilgqighgykyaigslnegri
    giaaqmlglaqgcfdytipyikeriqfgkrlfdfqglqhqvahvatqleaarlltynaar
    lleagkpfikeasmakyyaseiagqttskciewmggvgytkdypvekyfrdakigtiyeg
    asniqlntiakhidaey
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2jifC (C:)
    mhhhhhhssgvdlgtenlyfqsmaplqtftdeemmikssvkkfaqeqiaplvstmdensk
    meksviqglfqqglmgievdpeyggtgasflstvlvieelakvdasvavfceiqntlint
    lirkhgteeqkatylpqlttekvgsfclseagagsdsfalktradkegdyyvlngskmwi
    ssaehaglflvmanvdptigykgitsflvdrdtpglhigkpenklglrasstcpltfenv
    kvpeanilgqighgykyaigslnegrigiaaqmlglaqgcfdytipyikeriqfgkrlfd
    fqglqhqvahvatqleaarlltynaarlleagkpfikeasmakyyaseiagqttskciew
    mggvgytkdypvekyfrdakigtiyegasniqlntiakhidaey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jifC (C:)
    tftdeemmikssvkkfaqeqiaplvstmdenskmeksviqglfqqglmgievdpeyggtg
    asflstvlvieelakvdasvavfceiqntlintlirkhgteeqkatylpqlttekvgsfc
    lseagagsdsfalktradkegdyyvlngskmwissaehaglflvmanvdptigykgitsf
    lvdrdtpglhigkpenklglrasstcpltfenvkvpeanilgqighgykyaigslnegri
    giaaqmlglaqgcfdytipyikeriqfgkrlfdfqglqhqvahvatqleaarlltynaar
    lleagkpfikeasmakyyaseiagqttskciewmggvgytkdypvekyfrdakigtiyeg
    asniqlntiakhidaey
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2jifD (D:)
    mhhhhhhssgvdlgtenlyfqsmaplqtftdeemmikssvkkfaqeqiaplvstmdensk
    meksviqglfqqglmgievdpeyggtgasflstvlvieelakvdasvavfceiqntlint
    lirkhgteeqkatylpqlttekvgsfclseagagsdsfalktradkegdyyvlngskmwi
    ssaehaglflvmanvdptigykgitsflvdrdtpglhigkpenklglrasstcpltfenv
    kvpeanilgqighgykyaigslnegrigiaaqmlglaqgcfdytipyikeriqfgkrlfd
    fqglqhqvahvatqleaarlltynaarlleagkpfikeasmakyyaseiagqttskciew
    mggvgytkdypvekyfrdakigtiyegasniqlntiakhidaey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jifD (D:)
    aplqtftdeemmikssvkkfaqeqiaplvstmdenskmeksviqglfqqglmgievdpey
    ggtgasflstvlvieelakvdasvavfceiqntlintlirkhgteeqkatylpqlttekv
    gsfclseagagsdsfalktradkegdyyvlngskmwissaehaglflvmanvdptigykg
    itsflvdrdtpglhigkpenklglrasstcpltfenvkvpeanilgqighgykyaigsln
    egrigiaaqmlglaqgcfdytipyikeriqfgkrlfdfqglqhqvahvatqleaarllty
    naarlleagkpfikeasmakyyaseiagqttskciewmggvgytkdypvekyfrdakigt
    iyegasniqlntiakhidaey