PDB entry 2jie

View 2jie on RCSB PDB site
Description: beta-glucosidase b from bacillus polymyxa complexed with 2-f-glucose
Class: hydrolase
Keywords: glycosyl hydrolase family 1, carbohydrate metabolism, polysaccharide degradation, 2-f-glucose complex, cellulose degradation, hydrolase, glycosidase, beta-glucosidase
Deposited on 2007-02-28, released 2007-07-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2498
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase B
    Species: Paenibacillus polymyxa [TaxId:1406]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JIE
    • Uniprot P22505 (Start-453)
    Domains in SCOPe 2.06: d2jiea_
  • Heterogens: G2F, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jieA (A:)
    mhhhhhhsentfifpatfmwgtstssyqieggtdeggrtpsiwdtfcqipgkviggdcgd
    vacdhfhhfkedvqlmkqlgflhyrfsvawprimpaagiineegllfyehlldeielagl
    ipmltlyhwdlpqwiedeggwtqretiqhfktyasvimdrfgerinwwntinepycasil
    gygtgehapghenwreaftaahhilmchgiasnlhkekgltgkigitlnmehvdaaserp
    edvaaairrdgfinrwfaeplfngkypedmvewygtylngldfvqpgdmeliqqpgdflg
    inyytrsiirstndasllqveqvhmeepvtdmgweihpesfyklltriekdfskglpili
    tengaamrdelvngqiedtgrhgyieehlkachrfieeggqlkgyfvwsfldnfewawgy
    skrfgivhinyetqertpkqsalwfkqmmakngf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jieA (A:)
    ntfifpatfmwgtstssyqieggtdeggrtpsiwdtfcqipgkviggdcgdvacdhfhhf
    kedvqlmkqlgflhyrfsvawprimpaagiineegllfyehlldeielaglipmltlyhw
    dlpqwiedeggwtqretiqhfktyasvimdrfgerinwwntinepycasilgygtgehap
    ghenwreaftaahhilmchgiasnlhkekgltgkigitlnmehvdaaserpedvaaairr
    dgfinrwfaeplfngkypedmvewygtylngldfvqpgdmeliqqpgdflginyytrsii
    rstndasllqveqvhmeepvtdmgweihpesfyklltriekdfskglpilitengaamrd
    elvngqiedtgrhgyieehlkachrfieeggqlkgyfvwsfldnfewawgyskrfgivhi
    nyetqertpkqsalwfkqmmakngf