PDB entry 2jid

View 2jid on RCSB PDB site
Description: Human Dipeptidyl peptidase IV in complex with 1-(3,4-Dimethoxy-phenyl) -3-m-tolyl-piperidine-4-ylamine
Class: hydrolase
Keywords: hydrolase, diabetes type II, dipeptidyl peptidase, protease, membrane, b-propeller, structure based design, glycoprotein, signal-anchor, transmembrane, hydrolase fold, aminopeptidase, serine protease
Deposited on 2007-02-28, released 2008-05-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.227
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2jida1, d2jida2
  • Chain 'B':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2jidb1, d2jidb2
  • Heterogens: NAG, GVB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jidA (A:)
    gtddatadsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvfl
    enstfdefghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripn
    ntqwvtwspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsa
    ysalwwspngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffv
    vntdslssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdy
    dessgrwnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqid
    kkdctfitkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclsceln
    percqyysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmp
    skkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylast
    eniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgws
    yggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvms
    raenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqh
    iythmshfikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jidA (A:)
    srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
    ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
    pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
    vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
    clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
    kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
    vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfii
    lnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsm
    vlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshf
    ikqcfslp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jidB (B:)
    gtddatadsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvfl
    enstfdefghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripn
    ntqwvtwspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsa
    ysalwwspngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffv
    vntdslssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdy
    dessgrwnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqid
    kkdctfitkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclsceln
    percqyysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmp
    skkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylast
    eniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgws
    yggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvms
    raenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqh
    iythmshfikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jidB (B:)
    srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
    ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
    pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
    vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
    clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
    kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
    vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfii
    lnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsm
    vlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshf
    ikqcfslp