PDB entry 2jhq

View 2jhq on RCSB PDB site
Description: Crystal structure of Uracil DNA-glycosylase from Vibrio cholerae
Class: hydrolase
Keywords: mutational analysis, psychrophilic enzymes, ung, hydrolase, uracil-DNA n-glycosylase, cold adaptation, vibrio salmonicida, DNA damage, DNA repair, glycosidase
Deposited on 2007-02-23, released 2008-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.177
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil DNA-glycosylase
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jhqa_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jhqA (A:)
    msesltwhdvignekqqayfqqtlqfvesqrqagkviyppakdvfnafrftefgdvkvvi
    lgqdpyhgpnqahglcfsvlpgvktppslvniykelaqdipgfqipphgylqswaqqgvl
    llntvltveqgmahshantgwetftdrvidalnqhrnglifllwgshaqkkgqmidrqrh
    hvlmaphpsplsahrgflgcrhfsktnqllqaqgiapinwqpeles
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jhqA (A:)
    sltwhdvignekqqayfqqtlqfvesqrqagkviyppakdvfnafrftefgdvkvvilgq
    dpyhgpnqahglcfsvlpgvktppslvniykelaqdipgfqipphgylqswaqqgvllln
    tvltveqgmahshantgwetftdrvidalnqhrnglifllwgshaqkkgqmidrqrhhvl
    maphpsplsahrgflgcrhfsktnqllqaqgiapinwqpeles