PDB entry 2jgz

View 2jgz on RCSB PDB site
Description: crystal structure of phospho-cdk2 in complex with cyclin b
Class: transferase
Keywords: protein kinase, ubl conjugation, phosphorylation, serine/threonine-protein kinase, kinase, cyclin, mitosis, cell cycle, transferase, ATP-binding, polymorphism, cell division, nucleotide-binding, substrate specificity
Deposited on 2007-02-17, released 2007-05-22
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.208
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JGZ (0-0)
    • Uniprot P24941 (1-288)
    Domains in SCOPe 2.01: d2jgza_
  • Chain 'B':
    Compound: g2/mitotic-specific cyclin-b1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2jgzA (A:)
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqd

  • Chain 'B':
    No sequence available.