PDB entry 2jgu

View 2jgu on RCSB PDB site
Description: crystal structure of DNA-directed DNA polymerase
Class: transferase
Keywords: DNA-directed DNA polymerase, pfu, nuclease, hydrolase, transferase, DNA-binding, endonuclease, DNA replication, nucleotidyltransferase
Deposited on 2007-02-15, released 2008-04-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.2749
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61875 (0-End)
      • conflict (95)
      • conflict (168)
      • conflict (182)
      • conflict (185)
      • conflict (187)
      • conflict (264-265)
      • conflict (405-407)
    Domains in SCOPe 2.05: d2jgua1, d2jgua2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jguA (A:)
    mildvdyiteegkpvirlfkkengkfkiehdrtfrpyiyallrddskieevkkitgerhg
    kivrivdvekvekkflgkpitvwklylehpqdvptlrekvrehpavvdifeydipfakry
    lidkglipmegeeelkilafdietlyhegeefgkgpiimisyadenearvitwknidlpy
    vesvstekemikrflriirekdpdiivtyngdsfdfpylakraeklgikltigrdgsepk
    mqrigdmtavevkgrihfdlyhvirttinlptytleavyeaifgkpkekvyadeiakawe
    sgenlervakysmedakatyelgkeflpmeiqlsrlvgqplwdvsrsstgnlvewfllrk
    ayernevapnkpseeeyqrrlresytggfvkepekglwenivyldykslypsiiithnvs
    pdtlnlegcknydiapqvghkfckdipgfipsllghlleerqkiktkmketqdpiekill
    dyrqkaikllansfygyygyakarwyckecaesvtawgrkyielvwkeleekfgfkvlyi
    dtdglyatipggeseeikkkalefvkyinsklpglleleyegfykrgffvtkkryavide
    egkvitrgleivrrdwseiaketqarvletilkhgdveeavrivkeviqklanyeippek
    laiyeqitrplheykaigphvavakklaakgvkikpgmvigyivlrgdgpisnrailaee
    ydpkkhkydaeyyienqvlpavlrilegfgyrkedlryqktrqvgltswlnikks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jguA (A:)
    mildvdyiteegkpvirlfkkengkfkiehdrtfrpyiyallrddskieevkkitgerhg
    kivrivdvekvekkflgkpitvwklylehpqdvptlrekvrehpavvdifeydipfakry
    lidkglipmegeeelkilafdietlyhegeefgkgpiimisyadenearvitwknidlpy
    vesvstekemikrflriirekdpdiivtyngdsfdfpylakraeklgikltigrdgsepk
    mqrigdmtavevkgrihfdlyhvirttinlptytleavyeaifgkpkekvyadeiakawe
    sgenlervakysmedakatyelgkeflpmeiqlsrlvgqplwdvsrsstgnlvewfllrk
    ayernevapnkpseeeyqrrlresytggfvkepekglwenivyldykslypsiiithnvs
    pdtlnlegcknydiapqvghkfckdipgfipsllghlleerqkiktkmketqdpiekill
    dyrqkaikllansfygyygyakarwyckecaesvtawgrkyielvwkeleekfgfkvlyi
    dtdglyatipggeseeikkkalefvkyinsklpglleleyegfykrgffvtkkryavide
    egkvitrgleseiaketqarvletilkhgdveeavrivkeviqklanyeippeklaphva
    vakklaakgvkikpgmvigyivdaeyyienqvlpavlrilegfgyrkedlry