PDB entry 2jgn

View 2jgn on RCSB PDB site
Description: DDX3 helicase domain
Class: hydrolase
Keywords: phosphorylation, nucleotide-binding, helicase, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein, host-virus interaction
Deposited on 2007-02-13, released 2008-05-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.201
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent RNA helicase DDX3X
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jgna_
  • Chain 'B':
    Compound: ATP-dependent RNA helicase DDX3X
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JGN
    • Uniprot O00571 (13-End)
    Domains in SCOPe 2.07: d2jgnb_
  • Chain 'C':
    Compound: ATP-dependent RNA helicase DDX3X
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jgnc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jgnA (A:)
    mhhhhhhenlyfqgstsenitqkvvwveesdkrsflldllnatgkdsltlvfvetkkgad
    sledflyhegyactsihgdrsqrdreealhqfrsgkspilvatavaargldisnvkhvin
    fdlpsdieeyvhrigrtgrvgnlglatsffnerninitkdlldllveakqevpswlenma
    yehhy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jgnA (A:)
    tsenitqkvvwveesdkrsflldllnatkdsltlvfvetkkgadsledflyhegyactsi
    heealhqfrsgkspilvatadisnvkhvinfdlpsdieeyvhrigrtgrvgnlglatsff
    nerninitkdlldllveakqevpswlenmay
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jgnB (B:)
    mhhhhhhenlyfqgstsenitqkvvwveesdkrsflldllnatgkdsltlvfvetkkgad
    sledflyhegyactsihgdrsqrdreealhqfrsgkspilvatavaargldisnvkhvin
    fdlpsdieeyvhrigrtgrvgnlglatsffnerninitkdlldllveakqevpswlenma
    yehhy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jgnB (B:)
    gstsenitqkvvwveesdkrsflldllnatgsltlvfvetkkgadsledflyhegyacts
    ihgdrsqrdreealhqfrsgkspilvatavaisnvkhvinfdlpsdieeyvhrigrtgrv
    gnlglatsffnerninitkdlldllveakqevpswlenmay
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2jgnC (C:)
    mhhhhhhenlyfqgstsenitqkvvwveesdkrsflldllnatgkdsltlvfvetkkgad
    sledflyhegyactsihgdrsqrdreealhqfrsgkspilvatavaargldisnvkhvin
    fdlpsdieeyvhrigrtgrvgnlglatsffnerninitkdlldllveakqevpswlenma
    yehhy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jgnC (C:)
    senitqkvvwveesdkrsflldllntgsltlvfvetkkgadsledflyhegyactsihgd
    rsreealhqfrsgkspilvatavaargldisnvkhvinfdlpsdieeyvhrigrtgrvgn
    lglatsffnerninitkdlldllveakqevpswlenma