PDB entry 2jg7

View 2jg7 on RCSB PDB site
Description: crystal structure of seabream antiquitin and elucidation of its substrate specificity
Class: oxidoreductase
Keywords: aldehyde dehydrogenase, oxidoreductase
Deposited on 2007-02-09, released 2008-05-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.83 Å
R-factor: 0.211
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antiquitin
    Species: ACANTHOPAGRUS SCHLEGELI [TaxId:72011]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jg7a_
  • Chain 'B':
    Compound: antiquitin
    Species: ACANTHOPAGRUS SCHLEGELI [TaxId:72011]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jg7b_
  • Chain 'C':
    Compound: antiquitin
    Species: ACANTHOPAGRUS SCHLEGELI [TaxId:72011]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jg7c_
  • Chain 'D':
    Compound: antiquitin
    Species: ACANTHOPAGRUS SCHLEGELI [TaxId:72011]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jg7d_
  • Chain 'E':
    Compound: antiquitin
    Species: ACANTHOPAGRUS SCHLEGELI [TaxId:72011]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jg7e_
  • Chain 'F':
    Compound: antiquitin
    Species: ACANTHOPAGRUS SCHLEGELI [TaxId:72011]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jg7f_
  • Chain 'G':
    Compound: antiquitin
    Species: ACANTHOPAGRUS SCHLEGELI [TaxId:72011]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jg7g_
  • Chain 'H':
    Compound: antiquitin
    Species: ACANTHOPAGRUS SCHLEGELI [TaxId:72011]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jg7h_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jg7A (A:)
    sgllinqpkyswlkelglsednpgvyngswggsgevitsycpannepiarvtqatlaeye
    etvqktreawkmwadipapkrgeivrqigdalrkkikvlgslvslemgkiyvegvgevqe
    yvdvcdyavglsrmiggpvlpserpghalieqwnpvglvgiitafnfpvavygwnnaial
    tcgnvclwkgapttpltsvavtkivaevleqnnlpgaicsmtcggadigtamakdervdl
    lsftgsthvgkmvammvqerfgrkllelggnnaiivfedadlnlvvpsavfasvgtagqr
    ctttrrlmlhesvhdavveriakaykqvrigdpwdpstlygplhtkqavdqylaaieqak
    qqggtlvcggkvmdrpgnyveptiitglahdapivhtetfvpilyvlkfkteeeafawnn
    evqqglsssiftkdlgrvfrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresg
    sdswkqymrrstctinyskdlplaqgikfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jg7A (A:)
    sgllinqpkyswlkelglsednpgvyngswggsgevitsycpannepiarvtqatlaeye
    etvqktreawkmwadipapkrgeivrqigdalrkkikvlgslvslemgkiyvegvgevqe
    yvdvcdyavglsrmiggpvlpserpghalieqwnpvglvgiitafnfpvavygwnnaial
    tcgnvclwkgapttpltsvavtkivaevleqnnlpgaicsmtcggadigtamakdervdl
    lsftgsthvgkmvammvqerfgrkllelggnnaiivfedadlnlvvpsavfasvgtagqr
    ctttrrlmlhesvhdavveriakaykqvrigdpwdpstlygplhtkqavdqylaaieqak
    qqggtlvcggkvmdrpgnyveptiitglahdapivhtetfvpilyvlkfkteeeafawnn
    evqqglsssiftkdlgrvfrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresg
    sdswkqymrrstctinyskdlplaqgikf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jg7B (B:)
    sgllinqpkyswlkelglsednpgvyngswggsgevitsycpannepiarvtqatlaeye
    etvqktreawkmwadipapkrgeivrqigdalrkkikvlgslvslemgkiyvegvgevqe
    yvdvcdyavglsrmiggpvlpserpghalieqwnpvglvgiitafnfpvavygwnnaial
    tcgnvclwkgapttpltsvavtkivaevleqnnlpgaicsmtcggadigtamakdervdl
    lsftgsthvgkmvammvqerfgrkllelggnnaiivfedadlnlvvpsavfasvgtagqr
    ctttrrlmlhesvhdavveriakaykqvrigdpwdpstlygplhtkqavdqylaaieqak
    qqggtlvcggkvmdrpgnyveptiitglahdapivhtetfvpilyvlkfkteeeafawnn
    evqqglsssiftkdlgrvfrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresg
    sdswkqymrrstctinyskdlplaqgikfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jg7B (B:)
    sgllinqpkyswlkelglsednpgvyngswggsgevitsycpannepiarvtqatlaeye
    etvqktreawkmwadipapkrgeivrqigdalrkkikvlgslvslemgkiyvegvgevqe
    yvdvcdyavglsrmiggpvlpserpghalieqwnpvglvgiitafnfpvavygwnnaial
    tcgnvclwkgapttpltsvavtkivaevleqnnlpgaicsmtcggadigtamakdervdl
    lsftgsthvgkmvammvqerfgrkllelggnnaiivfedadlnlvvpsavfasvgtagqr
    ctttrrlmlhesvhdavveriakaykqvrigdpwdpstlygplhtkqavdqylaaieqak
    qqggtlvcggkvmdrpgnyveptiitglahdapivhtetfvpilyvlkfkteeeafawnn
    evqqglsssiftkdlgrvfrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresg
    sdswkqymrrstctinyskdlplaqgikf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2jg7C (C:)
    sgllinqpkyswlkelglsednpgvyngswggsgevitsycpannepiarvtqatlaeye
    etvqktreawkmwadipapkrgeivrqigdalrkkikvlgslvslemgkiyvegvgevqe
    yvdvcdyavglsrmiggpvlpserpghalieqwnpvglvgiitafnfpvavygwnnaial
    tcgnvclwkgapttpltsvavtkivaevleqnnlpgaicsmtcggadigtamakdervdl
    lsftgsthvgkmvammvqerfgrkllelggnnaiivfedadlnlvvpsavfasvgtagqr
    ctttrrlmlhesvhdavveriakaykqvrigdpwdpstlygplhtkqavdqylaaieqak
    qqggtlvcggkvmdrpgnyveptiitglahdapivhtetfvpilyvlkfkteeeafawnn
    evqqglsssiftkdlgrvfrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresg
    sdswkqymrrstctinyskdlplaqgikfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jg7C (C:)
    sgllinqpkyswlkelglsednpgvyngswggsgevitsycpannepiarvtqatlaeye
    etvqktreawkmwadipapkrgeivrqigdalrkkikvlgslvslemgkiyvegvgevqe
    yvdvcdyavglsrmiggpvlpserpghalieqwnpvglvgiitafnfpvavygwnnaial
    tcgnvclwkgapttpltsvavtkivaevleqnnlpgaicsmtcggadigtamakdervdl
    lsftgsthvgkmvammvqerfgrkllelggnnaiivfedadlnlvvpsavfasvgtagqr
    ctttrrlmlhesvhdavveriakaykqvrigdpwdpstlygplhtkqavdqylaaieqak
    qqggtlvcggkvmdrpgnyveptiitglahdapivhtetfvpilyvlkfkteeeafawnn
    evqqglsssiftkdlgrvfrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresg
    sdswkqymrrstctinyskdlplaqgikf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2jg7D (D:)
    sgllinqpkyswlkelglsednpgvyngswggsgevitsycpannepiarvtqatlaeye
    etvqktreawkmwadipapkrgeivrqigdalrkkikvlgslvslemgkiyvegvgevqe
    yvdvcdyavglsrmiggpvlpserpghalieqwnpvglvgiitafnfpvavygwnnaial
    tcgnvclwkgapttpltsvavtkivaevleqnnlpgaicsmtcggadigtamakdervdl
    lsftgsthvgkmvammvqerfgrkllelggnnaiivfedadlnlvvpsavfasvgtagqr
    ctttrrlmlhesvhdavveriakaykqvrigdpwdpstlygplhtkqavdqylaaieqak
    qqggtlvcggkvmdrpgnyveptiitglahdapivhtetfvpilyvlkfkteeeafawnn
    evqqglsssiftkdlgrvfrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresg
    sdswkqymrrstctinyskdlplaqgikfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jg7D (D:)
    sgllinqpkyswlkelglsednpgvyngswggsgevitsycpannepiarvtqatlaeye
    etvqktreawkmwadipapkrgeivrqigdalrkkikvlgslvslemgkiyvegvgevqe
    yvdvcdyavglsrmiggpvlpserpghalieqwnpvglvgiitafnfpvavygwnnaial
    tcgnvclwkgapttpltsvavtkivaevleqnnlpgaicsmtcggadigtamakdervdl
    lsftgsthvgkmvammvqerfgrkllelggnnaiivfedadlnlvvpsavfasvgtagqr
    ctttrrlmlhesvhdavveriakaykqvrigdpwdpstlygplhtkqavdqylaaieqak
    qqggtlvcggkvmdrpgnyveptiitglahdapivhtetfvpilyvlkfkteeeafawnn
    evqqglsssiftkdlgrvfrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresg
    sdswkqymrrstctinyskdlplaqgikf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2jg7E (E:)
    sgllinqpkyswlkelglsednpgvyngswggsgevitsycpannepiarvtqatlaeye
    etvqktreawkmwadipapkrgeivrqigdalrkkikvlgslvslemgkiyvegvgevqe
    yvdvcdyavglsrmiggpvlpserpghalieqwnpvglvgiitafnfpvavygwnnaial
    tcgnvclwkgapttpltsvavtkivaevleqnnlpgaicsmtcggadigtamakdervdl
    lsftgsthvgkmvammvqerfgrkllelggnnaiivfedadlnlvvpsavfasvgtagqr
    ctttrrlmlhesvhdavveriakaykqvrigdpwdpstlygplhtkqavdqylaaieqak
    qqggtlvcggkvmdrpgnyveptiitglahdapivhtetfvpilyvlkfkteeeafawnn
    evqqglsssiftkdlgrvfrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresg
    sdswkqymrrstctinyskdlplaqgikfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jg7E (E:)
    sgllinqpkyswlkelglsednpgvyngswggsgevitsycpannepiarvtqatlaeye
    etvqktreawkmwadipapkrgeivrqigdalrkkikvlgslvslemgkiyvegvgevqe
    yvdvcdyavglsrmiggpvlpserpghalieqwnpvglvgiitafnfpvavygwnnaial
    tcgnvclwkgapttpltsvavtkivaevleqnnlpgaicsmtcggadigtamakdervdl
    lsftgsthvgkmvammvqerfgrkllelggnnaiivfedadlnlvvpsavfasvgtagqr
    ctttrrlmlhesvhdavveriakaykqvrigdpwdpstlygplhtkqavdqylaaieqak
    qqggtlvcggkvmdrpgnyveptiitglahdapivhtetfvpilyvlkfkteeeafawnn
    evqqglsssiftkdlgrvfrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresg
    sdswkqymrrstctinyskdlplaqgikf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2jg7F (F:)
    sgllinqpkyswlkelglsednpgvyngswggsgevitsycpannepiarvtqatlaeye
    etvqktreawkmwadipapkrgeivrqigdalrkkikvlgslvslemgkiyvegvgevqe
    yvdvcdyavglsrmiggpvlpserpghalieqwnpvglvgiitafnfpvavygwnnaial
    tcgnvclwkgapttpltsvavtkivaevleqnnlpgaicsmtcggadigtamakdervdl
    lsftgsthvgkmvammvqerfgrkllelggnnaiivfedadlnlvvpsavfasvgtagqr
    ctttrrlmlhesvhdavveriakaykqvrigdpwdpstlygplhtkqavdqylaaieqak
    qqggtlvcggkvmdrpgnyveptiitglahdapivhtetfvpilyvlkfkteeeafawnn
    evqqglsssiftkdlgrvfrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresg
    sdswkqymrrstctinyskdlplaqgikfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jg7F (F:)
    sgllinqpkyswlkelglsednpgvyngswggsgevitsycpannepiarvtqatlaeye
    etvqktreawkmwadipapkrgeivrqigdalrkkikvlgslvslemgkiyvegvgevqe
    yvdvcdyavglsrmiggpvlpserpghalieqwnpvglvgiitafnfpvavygwnnaial
    tcgnvclwkgapttpltsvavtkivaevleqnnlpgaicsmtcggadigtamakdervdl
    lsftgsthvgkmvammvqerfgrkllelggnnaiivfedadlnlvvpsavfasvgtagqr
    ctttrrlmlhesvhdavveriakaykqvrigdpwdpstlygplhtkqavdqylaaieqak
    qqggtlvcggkvmdrpgnyveptiitglahdapivhtetfvpilyvlkfkteeeafawnn
    evqqglsssiftkdlgrvfrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresg
    sdswkqymrrstctinyskdlplaqgikf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2jg7G (G:)
    sgllinqpkyswlkelglsednpgvyngswggsgevitsycpannepiarvtqatlaeye
    etvqktreawkmwadipapkrgeivrqigdalrkkikvlgslvslemgkiyvegvgevqe
    yvdvcdyavglsrmiggpvlpserpghalieqwnpvglvgiitafnfpvavygwnnaial
    tcgnvclwkgapttpltsvavtkivaevleqnnlpgaicsmtcggadigtamakdervdl
    lsftgsthvgkmvammvqerfgrkllelggnnaiivfedadlnlvvpsavfasvgtagqr
    ctttrrlmlhesvhdavveriakaykqvrigdpwdpstlygplhtkqavdqylaaieqak
    qqggtlvcggkvmdrpgnyveptiitglahdapivhtetfvpilyvlkfkteeeafawnn
    evqqglsssiftkdlgrvfrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresg
    sdswkqymrrstctinyskdlplaqgikfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jg7G (G:)
    sgllinqpkyswlkelglsednpgvyngswggsgevitsycpannepiarvtqatlaeye
    etvqktreawkmwadipapkrgeivrqigdalrkkikvlgslvslemgkiyvegvgevqe
    yvdvcdyavglsrmiggpvlpserpghalieqwnpvglvgiitafnfpvavygwnnaial
    tcgnvclwkgapttpltsvavtkivaevleqnnlpgaicsmtcggadigtamakdervdl
    lsftgsthvgkmvammvqerfgrkllelggnnaiivfedadlnlvvpsavfasvgtagqr
    ctttrrlmlhesvhdavveriakaykqvrigdpwdpstlygplhtkqavdqylaaieqak
    qqggtlvcggkvmdrpgnyveptiitglahdapivhtetfvpilyvlkfkteeeafawnn
    evqqglsssiftkdlgrvfrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresg
    sdswkqymrrstctinyskdlplaqgikf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2jg7H (H:)
    sgllinqpkyswlkelglsednpgvyngswggsgevitsycpannepiarvtqatlaeye
    etvqktreawkmwadipapkrgeivrqigdalrkkikvlgslvslemgkiyvegvgevqe
    yvdvcdyavglsrmiggpvlpserpghalieqwnpvglvgiitafnfpvavygwnnaial
    tcgnvclwkgapttpltsvavtkivaevleqnnlpgaicsmtcggadigtamakdervdl
    lsftgsthvgkmvammvqerfgrkllelggnnaiivfedadlnlvvpsavfasvgtagqr
    ctttrrlmlhesvhdavveriakaykqvrigdpwdpstlygplhtkqavdqylaaieqak
    qqggtlvcggkvmdrpgnyveptiitglahdapivhtetfvpilyvlkfkteeeafawnn
    evqqglsssiftkdlgrvfrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresg
    sdswkqymrrstctinyskdlplaqgikfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jg7H (H:)
    sgllinqpkyswlkelglsednpgvyngswggsgevitsycpannepiarvtqatlaeye
    etvqktreawkmwadipapkrgeivrqigdalrkkikvlgslvslemgkiyvegvgevqe
    yvdvcdyavglsrmiggpvlpserpghalieqwnpvglvgiitafnfpvavygwnnaial
    tcgnvclwkgapttpltsvavtkivaevleqnnlpgaicsmtcggadigtamakdervdl
    lsftgsthvgkmvammvqerfgrkllelggnnaiivfedadlnlvvpsavfasvgtagqr
    ctttrrlmlhesvhdavveriakaykqvrigdpwdpstlygplhtkqavdqylaaieqak
    qqggtlvcggkvmdrpgnyveptiitglahdapivhtetfvpilyvlkfkteeeafawnn
    evqqglsssiftkdlgrvfrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresg
    sdswkqymrrstctinyskdlplaqgikf