PDB entry 2jfa

View 2jfa on RCSB PDB site
Description: estrogen receptor alpha lbd in complex with an affinity-selected corepressor peptide
Class: transcription
Keywords: transcription, transcription factor, phage display, metal-binding, corepressor, lipid-binding, transcription regulation, ligand-binding domain (lbd), nuclear protein, phosphorylation, steroid- binding, receptor, zinc-finger, DNA-binding, nuclear receptor, peptide antagonist
Deposited on 2007-01-29, released 2007-02-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.194
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2jfaa_
  • Chain 'B':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2jfab_
  • Chain 'P':
    Compound: corepressor peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 2JFA (0-End)
  • Chain 'Q':
    Compound: corepressor peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 2JFA (0-End)
  • Heterogens: RAL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jfaA (A:)
    mgsshhhhhhssglvprgshmenslalsltadqmvsalldaeppilyseydptrpfseas
    mmglltnladrelvhminwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgk
    llfapnllldrnqgkcvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytf
    lsstlksleekdhihrvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkg
    mehlysmkcknv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jfaA (A:)
    slalsltadqmvsalldaeppilyseypfseasmmglltnladrelvhminwakrvpgfv
    dltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdml
    latssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtlih
    lmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jfaB (B:)
    mgsshhhhhhssglvprgshmenslalsltadqmvsalldaeppilyseydptrpfseas
    mmglltnladrelvhminwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgk
    llfapnllldrnqgkcvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytf
    lsstlksleekdhihrvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkg
    mehlysmkcknv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jfaB (B:)
    lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
    gfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveif
    dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
    lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysm
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.