PDB entry 2jf7

View 2jf7 on RCSB PDB site
Description: Structure of Strictosidine Glucosidase
Class: hydrolase
Keywords: alkaloid, glucosidase, strictosidine, hydrolase
Deposited on 2007-01-26, released 2008-02-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-16, with a file datestamp of 2012-05-11.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: 0.186
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: strictosidine-o-beta-d-glucosidase
    Species: RAUVOLFIA SERPENTINA [TaxId:4060]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2jf7a_
  • Chain 'B':
    Compound: strictosidine-o-beta-d-glucosidase
    Species: RAUVOLFIA SERPENTINA [TaxId:4060]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2jf7b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jf7A (A:)
    mdntqaeplvvaivpkpnastehtnshlipvtrskivvhrrdfpqdfifgaggsayqceg
    aynegnrgpsiwdtftqrspakisdgsngnqaincyhmykedikimkqtglesyrfsisw
    srvlpggrlaagvnkdgvkfyhdfidellangikpsvtlfhwdlpqaledeyggflshri
    vddfceyaefcfwefgdkikywttfnephtfavngyalgefapgrggkgdegdpaiepyv
    vthnillahkaaveeyrnkfqkcqegeigivlnsmwmeplsdvqadidaqkraldfmlgw
    fleplttgdypksmrelvkgrlpkfsaddseklkgcydfigmnyytatyvtnavksnsek
    lsyetddqvtktfernqkpighalyggwqhvvpwglykllvytketyhvpvlyvtesgmv
    eenktkillsearrdaertdyhqkhlasvrdaiddgvnvkgyfvwsffdnfewnlgyicr
    ygiihvdyksferypkesaiwyknfiagksttspakrrreeaqvelvkrqkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jf7A (A:)
    vvhrrdfpqdfifgaggsayqcegaynegnrgpsiwdtftqrspakisdgsngnqaincy
    hmykedikimkqtglesyrfsiswsrvlpggrlaagvnkdgvkfyhdfidellangikps
    vtlfhwdlpqaledeyggflshrivddfceyaefcfwefgdkikywttfnephtfavngy
    algefapgrggkgdegdpaiepyvvthnillahkaaveeyrnkfqkcqegeigivlnsmw
    meplsdvqadidaqkraldfmlgwfleplttgdypksmrelvkgrlpkfsaddseklkgc
    ydfigmnyytatyvtnavklsyetddqvtktfernqkpighalyggwqhvvpwglykllv
    ytketyhvpvlyvtesgmveenktkillsearrdaertdyhqkhlasvrdaiddgvnvkg
    yfvwsffdnfewnlgyicrygiihvdyksferypkesaiwyknfiagk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jf7B (B:)
    mdntqaeplvvaivpkpnastehtnshlipvtrskivvhrrdfpqdfifgaggsayqceg
    aynegnrgpsiwdtftqrspakisdgsngnqaincyhmykedikimkqtglesyrfsisw
    srvlpggrlaagvnkdgvkfyhdfidellangikpsvtlfhwdlpqaledeyggflshri
    vddfceyaefcfwefgdkikywttfnephtfavngyalgefapgrggkgdegdpaiepyv
    vthnillahkaaveeyrnkfqkcqegeigivlnsmwmeplsdvqadidaqkraldfmlgw
    fleplttgdypksmrelvkgrlpkfsaddseklkgcydfigmnyytatyvtnavksnsek
    lsyetddqvtktfernqkpighalyggwqhvvpwglykllvytketyhvpvlyvtesgmv
    eenktkillsearrdaertdyhqkhlasvrdaiddgvnvkgyfvwsffdnfewnlgyicr
    ygiihvdyksferypkesaiwyknfiagksttspakrrreeaqvelvkrqkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jf7B (B:)
    vvhrrdfpqdfifgaggsayqcegaynegnrgpsiwdtftqrspakisdgsngnqaincy
    hmykedikimkqtglesyrfsiswsrvlpggrlaagvnkdgvkfyhdfidellangikps
    vtlfhwdlpqaledeyggflshrivddfceyaefcfwefgdkikywttfnephtfavngy
    algefapgrggkgdegdpaiepyvvthnillahkaaveeyrnkfqkcqegeigivlnsmw
    meplsdvqadidaqkraldfmlgwfleplttgdypksmrelvkgrlpkfsaddseklkgc
    ydfigmnyytatyvtnavlsyetddqvtktfernqkpighalyggwqhvvpwglykllvy
    tketyhvpvlyvtesgmveenktkillsearrdaertdyhqkhlasvrdaiddgvnvkgy
    fvwsffdnfewnlgyicrygiihvdyksferypkesaiwyknfiagk