PDB entry 2jf6

View 2jf6 on RCSB PDB site
Description: Structure of inactive mutant of Strictosidine Glucosidase in complex with strictosidine
Class: hydrolase
Keywords: alkaloid, hydrolase
Deposited on 2007-01-26, released 2008-02-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-16, with a file datestamp of 2012-05-11.
Experiment type: XRAY
Resolution: 2.82 Å
R-factor: 0.225
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: strictosidine-o-beta-d-glucosidase
    Species: RAUVOLFIA SERPENTINA [TaxId:4060]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jf6a_
  • Chain 'B':
    Compound: strictosidine-o-beta-d-glucosidase
    Species: RAUVOLFIA SERPENTINA [TaxId:4060]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jf6b_
  • Heterogens: S55, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jf6A (A:)
    mdntqaeplvvaivpkpnastehtnshlipvtrskivvhrrdfpqdfifgaggsayqceg
    aynegnrgpsiwdtftqrspakisdgsngnqaincyhmykedikimkqtglesyrfsisw
    srvlpggrlaagvnkdgvkfyhdfidellangikpsvtlfhwdlpqaledeyggflshri
    vddfceyaefcfwefgdkikywttfnephtfavngyalgefapgrggkgdegdpaiepyv
    vthnillahkaaveeyrnkfqkcqegeigivlnsmwmeplsdvqadidaqkraldfmlgw
    fleplttgdypksmrelvkgrlpkfsaddseklkgcydfigmnyytatyvtnavksnsek
    lsyetddqvtktfernqkpighalyggwqhvvpwglykllvytketyhvpvlyvtesgmv
    eenktkillsearrdaertdyhqkhlasvrdaiddgvnvkgyfvwsffdnfewnlgyicr
    ygiihvdyksferypkesaiwyknfiagksttspakrrreeaqvelvkrqkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jf6A (A:)
    vvhrrdfpqdfifgaggsayqcegaynegnrgpsiwdtftqrspakisdgsngnqincyh
    mykedikimkqtglesyrfsiswsrvlpggrlaagvnkdgvkfyhdfidellangikpsv
    tlfhwdlpqaledeyggflshrivddfceyaefcfwefgdkikywttfnephtfavngya
    lgefapgrggkgdegdpaiepyvvthnillahkaaveeyrnkfqkcqegeigivlnsmwm
    eplsdvqadidaqkraldfmlgwfleplttgdypksmrelvkgrlpkfsaddseklkgcy
    dfigmnyytatyvtnalsyetddqvtktfernqkpighalyggwqhvvpwglykllvytk
    etyhvpvlyvtesgmveenktkillsearrdaertdyhqkhlasvrdaiddgvnvkgyfv
    wsffdnfewnlgyicrygiihvdyksferypkesaiwyknfiag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jf6B (B:)
    mdntqaeplvvaivpkpnastehtnshlipvtrskivvhrrdfpqdfifgaggsayqceg
    aynegnrgpsiwdtftqrspakisdgsngnqaincyhmykedikimkqtglesyrfsisw
    srvlpggrlaagvnkdgvkfyhdfidellangikpsvtlfhwdlpqaledeyggflshri
    vddfceyaefcfwefgdkikywttfnephtfavngyalgefapgrggkgdegdpaiepyv
    vthnillahkaaveeyrnkfqkcqegeigivlnsmwmeplsdvqadidaqkraldfmlgw
    fleplttgdypksmrelvkgrlpkfsaddseklkgcydfigmnyytatyvtnavksnsek
    lsyetddqvtktfernqkpighalyggwqhvvpwglykllvytketyhvpvlyvtesgmv
    eenktkillsearrdaertdyhqkhlasvrdaiddgvnvkgyfvwsffdnfewnlgyicr
    ygiihvdyksferypkesaiwyknfiagksttspakrrreeaqvelvkrqkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jf6B (B:)
    vvhrrdfpqdfifgaggsayqcegaynegnrgpsiwdtftqrspakisdgsngnqaincy
    hmykedikimkqtglesyrfsiswsrvlpggrlaagvnkdgvkfyhdfidellangikps
    vtlfhwdlpqaledeyggflshrivddfceyaefcfwefgdkikywttfnephtfavngy
    algefapgrggkgdegdpaiepyvvthnillahkaaveeyrnkfqkcqegeigivlnsmw
    meplsdvqadidaqkraldfmlgwfleplttgdypksmrelvkgrlpkfsaddseklkgc
    ydfigmnyytatyvtnavksnseklsyetddqvtktfernqkpighalyggwqhvvpwgl
    ykllvytketyhvpvlyvtesgmveenktkillsearrdaertdyhqkhlasvrdaiddg
    vnvkgyfvwsffdnfewnlgyicrygiihvdyksferypkesaiwyknfiag