PDB entry 2je8

View 2je8 on RCSB PDB site
Description: structure of a beta-mannosidase from bacteroides thetaiotaomicron
Class: hydrolase
Keywords: beta-mannosidase, glycoside hydrolase, hydrolase
Deposited on 2007-01-16, released 2007-02-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.157
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-mannosidase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2JE8
    • Uniprot Q8AAK6 (Start-840)
    Domains in SCOPe 2.03: d2je8a1, d2je8a2, d2je8a3, d2je8a4, d2je8a5
  • Chain 'B':
    Compound: beta-mannosidase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2JE8 (841-End)
    • Uniprot Q8AAK6 (Start-840)
    Domains in SCOPe 2.03: d2je8b1, d2je8b2, d2je8b3, d2je8b4, d2je8b5
  • Heterogens: B3P, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2je8A (A:)
    mgqgndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqw
    venedweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvks
    vlrkgenhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgir
    mvtsgvwrpvtlrfydiatisdyyvrqlsltdenarlsnelivnqivpqkipaevrvnvs
    lngttvtevkqqvtlqpginhitlpaevtnpvrwmpngwgtptlydfsaqiacgdrivae
    qshriglrtirvvnekdkdgesfyfevngipmfakganyipqdallpnvtteryqtlfrd
    mkeanmnmvriwgggtyennlfydladengilvwqdfmfactpypsdptflkrveaeavy
    nirrlrnhaslamwcgnneilealkywgfekkftpevyqglmhgydklfrellpstvkef
    dsdrfyvhsspylanwgrpeswgtgdshnwgvwygkkpfesldtdlprfmsefgfqsfpe
    mktiaafaapedyqiesevmnahqkssignslirtymerdyiipesfedfvyvglvlqgq
    gmrhgleahrrnrpycmgtlywqlndswpvvswssidyygnwkalhyqakrafapvlinp
    iqqndslsvylisdrldtmeqmtlemkvvdfdgktlgkkiqvhslevpantskcvyrakl
    dgwltpedcrrsflklilkdksghqvaesvhffrktkdlqlpptsvsyqmkqtdgkcelt
    lfssmlakdifietplqgarysdnffdllpgerkkviitsprikkgeelpvnikhirety
    kehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2je8A (A:)
    ndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwvene
    dweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvlrk
    genhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmvts
    gvwrpvtlrfydiatisdyyvrqlsltdenarlsnelivnqivpqkipaevrvnvslngt
    tvtevkqqvtlqpginhitlpaevtnpvrwmpngwgtptlydfsaqiacgdrivaeqshr
    iglrtirvvnekdkdgesfyfevngipmfakganyipqdallpnvtteryqtlfrdmkea
    nmnmvriwgggtyennlfydladengilvwqdfmfactpypsdptflkrveaeavynirr
    lrnhaslamwcgnneilealkywgfekkftpevyqglmhgydklfrellpstvkefdsdr
    fyvhsspylanwgrpeswgtgdshnwgvwygkkpfesldtdlprfmsefgfqsfpemkti
    aafaapedyqiesevmnahqkssignslirtymerdyiipesfedfvyvglvlqgqgmrh
    gleahrrnrpycmgtlywqlndswpvvswssidyygnwkalhyqakrafapvlinpiqqn
    dslsvylisdrldtmeqmtlemkvvdfdgktlgkkiqvhslevpantskcvyrakldgwl
    tpedcrrsflklilkdksghqvaesvhffrktkdlqlpptsvsyqmkqtdgkceltlfss
    mlakdifietplqgarysdnffdllpgerkkviitsprikkgeelpvnikhiretyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2je8B (B:)
    mgqgndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqw
    venedweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvks
    vlrkgenhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgir
    mvtsgvwrpvtlrfydiatisdyyvrqlsltdenarlsnelivnqivpqkipaevrvnvs
    lngttvtevkqqvtlqpginhitlpaevtnpvrwmpngwgtptlydfsaqiacgdrivae
    qshriglrtirvvnekdkdgesfyfevngipmfakganyipqdallpnvtteryqtlfrd
    mkeanmnmvriwgggtyennlfydladengilvwqdfmfactpypsdptflkrveaeavy
    nirrlrnhaslamwcgnneilealkywgfekkftpevyqglmhgydklfrellpstvkef
    dsdrfyvhsspylanwgrpeswgtgdshnwgvwygkkpfesldtdlprfmsefgfqsfpe
    mktiaafaapedyqiesevmnahqkssignslirtymerdyiipesfedfvyvglvlqgq
    gmrhgleahrrnrpycmgtlywqlndswpvvswssidyygnwkalhyqakrafapvlinp
    iqqndslsvylisdrldtmeqmtlemkvvdfdgktlgkkiqvhslevpantskcvyrakl
    dgwltpedcrrsflklilkdksghqvaesvhffrktkdlqlpptsvsyqmkqtdgkcelt
    lfssmlakdifietplqgarysdnffdllpgerkkviitsprikkgeelpvnikhirety
    kehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2je8B (B:)
    gndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwven
    edweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvlr
    kgenhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmvt
    sgvwrpvtlrfydiatisdyyvrqlsltdenarlsnelivnqivpqkipaevrvnvslng
    ttvtevkqqvtlqpginhitlpaevtnpvrwmpngwgtptlydfsaqiacgdrivaeqsh
    riglrtirvvnekdkdgesfyfevngipmfakganyipqdallpnvtteryqtlfrdmke
    anmnmvriwgggtyennlfydladengilvwqdfmfactpypsdptflkrveaeavynir
    rlrnhaslamwcgnneilealkywgfekkftpevyqglmhgydklfrellpstvkefdsd
    rfyvhsspylanwgrpeswgtgdshnwgvwygkkpfesldtdlprfmsefgfqsfpemkt
    iaafaapedyqiesevmnahqkssignslirtymerdyiipesfedfvyvglvlqgqgmr
    hgleahrrnrpycmgtlywqlndswpvvswssidyygnwkalhyqakrafapvlinpiqq
    ndslsvylisdrldtmeqmtlemkvvdfdgktlgkkiqvhslevpantskcvyrakldgw
    ltpedcrrsflklilkdksghqvaesvhffrktkdlqlpptsvsyqmkqtdgkceltlfs
    smlakdifietplqgarysdnffdllpgerkkviitsprikkgeelpvnikhiretykeh
    h