PDB entry 2jdq

View 2jdq on RCSB PDB site
Description: c-terminal domain of influenza a virus polymerase pb2 subunit in complex with human importin alpha5
Class: protein transport
Keywords: transport, pb2 subunit, nuclear protein, protein transport, armadillo repeats, influenza a virus RNA-dependent RNA polymerase, bipartite nuclear localisation signal, nuclear import adapter, human importin alpha5, host-virus interaction
Deposited on 2007-01-11, released 2007-02-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.208
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: importin alpha-1 subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2jdqa_
  • Chain 'B':
    Compound: importin alpha-1 subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2jdqb_
  • Chain 'D':
    Compound: Polymerase basic protein 2
    Species: INFLUENZA A VIRUS [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2jdqd_
  • Chain 'E':
    Compound: Polymerase basic protein 2
    Species: INFLUENZA A VIRUS [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2jdqe_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jdqA (A:)
    gamgfheaqinnmemapggvitsdmiemifskspeqqlsatqkfrkllskepnppidevi
    stpgvvarfveflkrkenctlqfesawvltniasgnslqtriviqagavpifiellssef
    edvqeqavwalgniagdstmcrdyvldcnilppllqlfskqnrltmtrnavwalsnlcrg
    kspppefakvspclnvlswllfvsdtdvladacwalsylsdgpndkiqavidagvcrrlv
    ellmhndykvvspalravgnivtgddiqtqvilncsalqsllhllsspkesikkeacwti
    snitagnraqiqtvidanifpalisilqtaefrtrkeaawaitnatsggsaeqikylvel
    gcikplcdlltvmdskivqvalnglenilrlgeqeakrngtginpycalieeaygldkie
    flqshenqeiyqkafdliehyfgtededss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jdqA (A:)
    tsdmiemifskspeqqlsatqkfrkllskepnppidevistpgvvarfveflkrkenctl
    qfesawvltniasgnslqtriviqagavpifiellssefedvqeqavwalgniagdstmc
    rdyvldcnilppllqlfskqnrltmtrnavwalsnlcrgkspppefakvspclnvlswll
    fvsdtdvladacwalsylsdgpndkiqavidagvcrrlvellmhndykvvspalravgni
    vtgddiqtqvilncsalqsllhllsspkesikkeacwtisnitagnraqiqtvidanifp
    alisilqtaefrtrkeaawaitnatsggsaeqikylvelgcikplcdlltvmdskivqva
    lnglenilrlgeqeakrngtginpycalieeaygldkieflqshenqeiyqkafdliehy
    fgte
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jdqB (B:)
    gamgfheaqinnmemapggvitsdmiemifskspeqqlsatqkfrkllskepnppidevi
    stpgvvarfveflkrkenctlqfesawvltniasgnslqtriviqagavpifiellssef
    edvqeqavwalgniagdstmcrdyvldcnilppllqlfskqnrltmtrnavwalsnlcrg
    kspppefakvspclnvlswllfvsdtdvladacwalsylsdgpndkiqavidagvcrrlv
    ellmhndykvvspalravgnivtgddiqtqvilncsalqsllhllsspkesikkeacwti
    snitagnraqiqtvidanifpalisilqtaefrtrkeaawaitnatsggsaeqikylvel
    gcikplcdlltvmdskivqvalnglenilrlgeqeakrngtginpycalieeaygldkie
    flqshenqeiyqkafdliehyfgtededss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jdqB (B:)
    tsdmiemifskspeqqlsatqkfrkllskepnppidevistpgvvarfveflkrkenctl
    qfesawvltniasgnslqtriviqagavpifiellssefedvqeqavwalgniagdstmc
    rdyvldcnilppllqlfskqnrltmtrnavwalsnlcrgkspppefakvspclnvlswll
    fvsdtdvladacwalsylsdgpndkiqavidagvcrrlvellmhndykvvspalravgni
    vtgddiqtqvilncsalqsllhllsspkesikkeacwtisnitagnraqiqtvidanifp
    alisilqtaefrtrkeaawaitnatsggsaeqikylvelgcikplcdlltvmdskivqva
    lnglenilrlgeqeakrngtginpycalieeaygldkieflqshenqeiyqkafdliehy
    fgtede
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2jdqD (D:)
    gdpdestsgvesavlrgflilgkedrrygpalsinelsnlakgekanvligqgdvvlvmk
    rkrdssiltdsqtatkrirmain
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jdqD (D:)
    savlrgflilgkedrrygpalsinelsnlakgekanvligqgdvvlvmkrkrdsqtatkr
    irm
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2jdqE (E:)
    gdpdestsgvesavlrgflilgkedrrygpalsinelsnlakgekanvligqgdvvlvmk
    rkrdssiltdsqtatkrirmain
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jdqE (E:)
    vesavlrgflilgkedrrygpalsinelsnlakgekanvligqgdvvlvmkrkrdstatk
    rirma