PDB entry 2jdo

View 2jdo on RCSB PDB site
Description: structure of pkb-beta (akt2) complexed with isoquinoline-5-sulfonic acid (2-(2-(4-chlorobenzyloxy) ethylamino)ethyl) amide
Class: transferase
Keywords: wnt signaling pathway, serine/threonine-protein kinase, kinase, transferase, ATP-binding, phosphorylation, nucleotide-binding, alternative splicing
Deposited on 2007-01-11, released 2007-02-13
The last revision prior to the SCOP 1.73 freeze date was dated 2007-03-13, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.177
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rac-beta serine/threonine-protein kinase
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2JDO (Start-341)
    • Uniprot P31751 (5-End)
    Domains in SCOP 1.73: d2jdoa1
  • Chain 'C':
    Compound: Glycogen synthase kinase-3 beta
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: I5S, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jdoA (A:)
    gamdpkvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvte
    srvlqntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeiv
    saleylhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylape
    vledndygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksl
    lagllkkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfd
    deftaqsititppdrydslglleldqreeqemfedfdyiadw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jdoA (A:)
    kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq
    ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley
    lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn
    dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll
    kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta
    qsitmfedfdyiadw
    

  • Chain 'C':
    No sequence available.